Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 41376..41590 | Replicon | plasmid pBE11_1 |
Accession | NZ_CP110070 | ||
Organism | Enterococcus faecalis strain BE11 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | OLL93_RS14355 | Protein ID | WP_002360667.1 |
Coordinates | 41376..41486 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 41526..41590 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLL93_RS14310 | 36610..37134 | + | 525 | WP_002360677.1 | hypothetical protein | - |
OLL93_RS14315 | 37297..37917 | + | 621 | WP_025188285.1 | recombinase family protein | - |
OLL93_RS14320 | 37907..38221 | + | 315 | WP_025188489.1 | hypothetical protein | - |
OLL93_RS14325 | 38215..38439 | + | 225 | WP_002414746.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
OLL93_RS14330 | 38500..38709 | + | 210 | WP_002399367.1 | hypothetical protein | - |
OLL93_RS14335 | 38721..39023 | + | 303 | WP_002393766.1 | DUF6440 family protein | - |
OLL93_RS14340 | 39451..40778 | + | 1328 | Protein_48 | Y-family DNA polymerase | - |
OLL93_RS14345 | 40775..41125 | + | 351 | WP_010784817.1 | hypothetical protein | - |
OLL93_RS14350 | 41082..41294 | + | 213 | WP_002406179.1 | hypothetical protein | - |
OLL93_RS14355 | 41376..41486 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 41526..41590 | - | 65 | - | - | Antitoxin |
OLL93_RS14360 | 41726..42016 | + | 291 | WP_001137528.1 | hypothetical protein | - |
OLL93_RS14365 | 42120..42491 | - | 372 | WP_000049959.1 | replication-associated protein RepC | - |
OLL93_RS14370 | 42484..43329 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..43800 | 43800 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T263021 WP_002360667.1 NZ_CP110070:41376-41486 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
Antitoxin
Download Length: 65 bp
>AT263021 NZ_CP110070:c41590-41526 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|