Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 317728..317922 | Replicon | chromosome |
Accession | NZ_CP110069 | ||
Organism | Enterococcus faecalis strain BE11 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | OLL93_RS01605 | Protein ID | WP_015543884.1 |
Coordinates | 317827..317922 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 317728..317792 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLL93_RS01590 | 313346..315088 | + | 1743 | WP_002391519.1 | PTS transporter subunit EIIC | - |
OLL93_RS01595 | 315079..317112 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
OLL93_RS01600 | 317123..317557 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 317728..317792 | + | 65 | - | - | Antitoxin |
OLL93_RS01605 | 317827..317922 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
OLL93_RS01610 | 318168..319940 | + | 1773 | WP_002391520.1 | PTS mannitol-specific transporter subunit IIBC | - |
OLL93_RS01615 | 319955..320392 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
OLL93_RS01620 | 320407..321561 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
OLL93_RS01625 | 321630..322745 | - | 1116 | WP_002364956.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T263003 WP_015543884.1 NZ_CP110069:c317922-317827 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT263003 NZ_CP110069:317728-317792 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|