Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 329294..329489 | Replicon | chromosome |
Accession | NZ_CP110068 | ||
Organism | Enterococcus faecalis strain BE13 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | OLM02_RS01675 | Protein ID | WP_122975133.1 |
Coordinates | 329394..329489 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 329294..329359 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM02_RS01660 | 324921..326669 | + | 1749 | WP_010821363.1 | PTS transporter subunit EIIC | - |
OLM02_RS01665 | 326660..328693 | + | 2034 | WP_002361171.1 | PRD domain-containing protein | - |
OLM02_RS01670 | 328704..329138 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 329294..329359 | + | 66 | - | - | Antitoxin |
OLM02_RS01675 | 329394..329489 | - | 96 | WP_122975133.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
OLM02_RS01680 | 329735..331507 | + | 1773 | WP_010821364.1 | PTS mannitol-specific transporter subunit IIBC | - |
OLM02_RS01685 | 331522..331959 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
OLM02_RS01690 | 331974..333128 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
OLM02_RS01695 | 333196..334311 | - | 1116 | WP_010821365.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3645.44 Da Isoelectric Point: 4.5869
>T262988 WP_122975133.1 NZ_CP110068:c329489-329394 [Enterococcus faecalis]
MYDIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYDIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 66 bp
>AT262988 NZ_CP110068:329294-329359 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|