Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
| Location | 21986..22218 | Replicon | plasmid pBE15_2 |
| Accession | NZ_CP110065 | ||
| Organism | Enterococcus faecalis strain BE15 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | OLL96_RS14595 | Protein ID | WP_002387930.1 |
| Coordinates | 21986..22087 (+) | Length | 34 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 22127..22218 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL96_RS14550 (17227) | 17227..17514 | + | 288 | WP_010778046.1 | hypothetical protein | - |
| OLL96_RS14560 (18817) | 18817..19041 | + | 225 | WP_002395938.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
| OLL96_RS14565 (19102) | 19102..19311 | + | 210 | WP_064686952.1 | hypothetical protein | - |
| OLL96_RS14570 (19323) | 19323..19496 | + | 174 | WP_002395320.1 | hypothetical protein | - |
| OLL96_RS14575 (19514) | 19514..19624 | + | 111 | WP_229235047.1 | DUF6440 family protein | - |
| OLL96_RS14580 (20051) | 20051..21379 | + | 1329 | WP_010717412.1 | ultraviolet resistance protein UvrA | - |
| OLL96_RS14585 (21376) | 21376..21726 | + | 351 | WP_002395322.1 | hypothetical protein | - |
| OLL96_RS14590 (21683) | 21683..21895 | + | 213 | WP_002395323.1 | hypothetical protein | - |
| OLL96_RS14595 (21986) | 21986..22087 | + | 102 | WP_002387930.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - (22127) | 22127..22218 | - | 92 | NuclAT_0 | - | Antitoxin |
| - (22127) | 22127..22218 | - | 92 | NuclAT_0 | - | Antitoxin |
| - (22127) | 22127..22218 | - | 92 | NuclAT_0 | - | Antitoxin |
| - (22127) | 22127..22218 | - | 92 | NuclAT_0 | - | Antitoxin |
| OLL96_RS14600 (22328) | 22328..22624 | + | 297 | WP_010717413.1 | hypothetical protein | - |
| OLL96_RS14605 (22878) | 22878..23660 | + | 783 | WP_002369746.1 | ParA family protein | - |
| OLL96_RS14610 (23653) | 23653..24009 | + | 357 | WP_002360663.1 | hypothetical protein | - |
| OLL96_RS14615 (24269) | 24269..25282 | + | 1014 | WP_002396062.1 | replication initiator protein A | - |
| OLL96_RS14620 (25413) | 25413..25691 | + | 279 | WP_010778048.1 | hypothetical protein | - |
| OLL96_RS14625 (25728) | 25728..26408 | + | 681 | WP_002319817.1 | IS6-like element ISS1N family transposase | - |
| OLL96_RS14630 (26549) | 26549..26857 | + | 309 | Protein_36 | ATP-binding cassette domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..30220 | 30220 | |
| - | flank | IS/Tn | - | - | 25728..26408 | 680 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 34 a.a. Molecular weight: 3731.42 Da Isoelectric Point: 4.1672
>T262985 WP_002387930.1 NZ_CP110065:21986-22087 [Enterococcus faecalis]
VKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
VKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
Download Length: 102 bp
Antitoxin
Download Length: 92 bp
>AT262985 NZ_CP110065:c22218-22127 [Enterococcus faecalis]
TAAAAATATGTTATACTATAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
TAAAAATATGTTATACTATAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
