Detailed information of TA system TA262983

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): fst-RNAII/Fst(toxin)
• Location: 21986..22191
• Replicon: plasmid pBE15_2
• Accession: NZ_CP110065
• Organism: Enterococcus faecalis strain BE15

Toxin (Protein)

• Gene name: fst
• Uniprot ID: -
• Locus tag: OLL96_RS14595
• Protein ID: WP_002387930.1
• Coordinates: 21986..22087 (+)
• Length: 34 a.a.

Antitoxin (RNA)

Gene name	RNAII
Locus tag	-
Coordinates	22127..22191 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OLL96_RS14550	17227..17514	+	288	WP_010778046.1	hypothetical protein	-
OLL96_RS14560	18817..19041	+	225	WP_002395938.1	ultraviolet resistance protein UvrA repressor UvrC	-
OLL96_RS14565	19102..19311	+	210	WP_064686952.1	hypothetical protein	-
OLL96_RS14570	19323..19496	+	174	WP_002395320.1	hypothetical protein	-
OLL96_RS14575	19514..19624	+	111	WP_229235047.1	DUF6440 family protein	-
OLL96_RS14580	20051..21379	+	1329	WP_010717412.1	ultraviolet resistance protein UvrA	-
OLL96_RS14585	21376..21726	+	351	WP_002395322.1	hypothetical protein	-
OLL96_RS14590	21683..21895	+	213	WP_002395323.1	hypothetical protein	-
OLL96_RS14595	21986..22087	+	102	WP_002387930.1	type I toxin-antitoxin system Fst family toxin	Toxin
-	22127..22191	-	65	-	-	Antitoxin
OLL96_RS14600	22328..22624	+	297	WP_010717413.1	hypothetical protein	-
OLL96_RS14605	22878..23660	+	783	WP_002369746.1	ParA family protein	-
OLL96_RS14610	23653..24009	+	357	WP_002360663.1	hypothetical protein	-
OLL96_RS14615	24269..25282	+	1014	WP_002396062.1	replication initiator protein A	-
OLL96_RS14620	25413..25691	+	279	WP_010778048.1	hypothetical protein	-
OLL96_RS14625	25728..26408	+	681	WP_002319817.1	IS6-like element ISS1N family transposase	-
OLL96_RS14630	26549..26857	+	309	Protein_36	ATP-binding cassette domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	-	-	1..30220	30220
	-	flank	IS/Tn	-	-	25728..26408	680

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Sequences

Toxin

Protein

• Length: 34 a.a.
• Molecular weight: 3731.42 Da
• Isoelectric Point: 4.1672

>T262983 WP_002387930.1 NZ_CP110065:21986-22087 [Enterococcus faecalis]
VKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK

Nucleotide

• Length: 102 bp

Antitoxin

Nucleotide

• Length: 65 bp

>AT262983 NZ_CP110065:c22191-22127 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT

Structures

Antitoxin