Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-RNAII/- |
| Location | 2815785..2816070 | Replicon | chromosome |
| Accession | NZ_CP110063 | ||
| Organism | Enterococcus faecalis strain BE15 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A3N3Z2N6 |
| Locus tag | OLL96_RS13790 | Protein ID | WP_073340360.1 |
| Coordinates | 2815930..2816070 (+) | Length | 47 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 2815785..2815928 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL96_RS13770 | 2811137..2812129 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| OLL96_RS13775 | 2812393..2813031 | - | 639 | WP_073438309.1 | lytic polysaccharide monooxygenase | - |
| OLL96_RS13780 | 2813717..2815333 | + | 1617 | WP_002406969.1 | phosphatase PAP2/LCP family protein | - |
| OLL96_RS13785 | 2815662..2815811 | + | 150 | WP_002411240.1 | type I toxin-antitoxin system toxin PepG1 | - |
| OLL96_RS13790 | 2815930..2816070 | + | 141 | WP_073340360.1 | putative holin-like toxin | Toxin |
| - | 2816003..2816204 | - | 202 | - | - | - |
| OLL96_RS13795 | 2816301..2816444 | + | 144 | WP_073437820.1 | putative holin-like toxin | - |
| OLL96_RS13800 | 2816577..2817536 | + | 960 | WP_002360751.1 | IS30-like element IS1062 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2816577..2817536 | 959 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 47 a.a. Molecular weight: 5218.33 Da Isoelectric Point: 10.3265
>T262978 WP_073340360.1 NZ_CP110063:2815930-2816070 [Enterococcus faecalis]
ISLKNTNKNIVYCTTYETIQTILGFGMFTIALIALIVKLLKNDKKK
ISLKNTNKNIVYCTTYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 141 bp
Antitoxin
Download Length: 144 bp
>AT262978 NZ_CP110063:c2815928-2815785 [Enterococcus faecalis]
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTAAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAA
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTAAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|