Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2759484..2759925 | Replicon | chromosome |
| Accession | NZ_CP110059 | ||
| Organism | Enterococcus faecalis strain BE16 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | E2Z0W4 |
| Locus tag | OLL92_RS13455 | Protein ID | WP_002381035.1 |
| Coordinates | 2759782..2759925 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2759484..2759685 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL92_RS13430 (2754799) | 2754799..2755431 | - | 633 | WP_002358972.1 | RloB family protein | - |
| OLL92_RS13435 (2755440) | 2755440..2756735 | - | 1296 | WP_010820355.1 | ATP-binding protein | - |
| OLL92_RS13440 (2757197) | 2757197..2758813 | + | 1617 | WP_002372620.1 | phosphatase PAP2/LCP family protein | - |
| OLL92_RS13445 (2759143) | 2759143..2759292 | + | 150 | WP_002411240.1 | type I toxin-antitoxin system toxin PepG1 | - |
| - (2759225) | 2759225..2759409 | - | 185 | NuclAT_5 | - | - |
| - (2759266) | 2759266..2759409 | - | 144 | NuclAT_7 | - | - |
| OLL92_RS13450 (2759411) | 2759411..2759551 | + | 141 | WP_104875700.1 | putative holin-like toxin | - |
| - (2759484) | 2759484..2759685 | - | 202 | NuclAT_4 | - | Antitoxin |
| OLL92_RS13455 (2759782) | 2759782..2759925 | + | 144 | WP_002381035.1 | putative holin-like toxin | Toxin |
| - (2760069) | 2760069..2760118 | + | 50 | NuclAT_8 | - | - |
| - (2759857) | 2759857..2760119 | - | 263 | NuclAT_6 | - | - |
| OLL92_RS13460 (2760120) | 2760120..2763053 | - | 2934 | WP_264547767.1 | WxL domain-containing protein | - |
| OLL92_RS13465 (2763040) | 2763040..2763402 | - | 363 | WP_002370158.1 | LPXTG cell wall anchor domain-containing protein | - |
| OLL92_RS13470 (2763789) | 2763789..2764736 | - | 948 | WP_002358958.1 | 1,4-dihydroxy-2-naphthoate polyprenyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5202.20 Da Isoelectric Point: 10.0041
>T262953 WP_002381035.1 NZ_CP110059:2759782-2759925 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
Download Length: 144 bp
Antitoxin
Download Length: 202 bp
>AT262953 NZ_CP110059:c2759685-2759484 [Enterococcus faecalis]
GTTTTTTTAGGTGATTGTGCTGTAATAGCAATGAAAAGAGAGATATGCGCCAACATACCTCTCTGATGTAGAGCCGTTTA
AGACGGTGATCTTTTTGATTATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCA
ATTTCACAATCAGTGCAATCAAAGCAATGGTAAACATACCAA
GTTTTTTTAGGTGATTGTGCTGTAATAGCAATGAAAAGAGAGATATGCGCCAACATACCTCTCTGATGTAGAGCCGTTTA
AGACGGTGATCTTTTTGATTATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCA
ATTTCACAATCAGTGCAATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|