Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 343788..343982 | Replicon | chromosome |
Accession | NZ_CP110059 | ||
Organism | Enterococcus faecalis strain BE16 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | OLL92_RS01785 | Protein ID | WP_162781186.1 |
Coordinates | 343887..343982 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 343788..343852 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLL92_RS01770 (339406) | 339406..341148 | + | 1743 | WP_002397018.1 | PTS transporter subunit EIIC | - |
OLL92_RS01775 (341139) | 341139..343172 | + | 2034 | WP_002361171.1 | PRD domain-containing protein | - |
OLL92_RS01780 (343183) | 343183..343617 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- (343788) | 343788..343852 | + | 65 | NuclAT_10 | - | Antitoxin |
OLL92_RS01785 (343887) | 343887..343982 | - | 96 | WP_162781186.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
OLL92_RS01790 (344228) | 344228..346000 | + | 1773 | WP_025186229.1 | PTS mannitol-specific transporter subunit IIBC | - |
OLL92_RS01795 (346015) | 346015..346452 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
OLL92_RS01800 (346467) | 346467..347621 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
OLL92_RS01805 (347690) | 347690..348805 | - | 1116 | WP_002361174.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3658.53 Da Isoelectric Point: 8.6635
>T262938 WP_162781186.1 NZ_CP110059:c343982-343887 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNKE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNKE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT262938 NZ_CP110059:343788-343852 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|