Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2759078..2759344 | Replicon | chromosome |
Accession | NZ_CP110054 | ||
Organism | Enterococcus faecalis strain BE17 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | OLL95_RS13445 | Protein ID | WP_002411240.1 |
Coordinates | 2759078..2759227 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2759160..2759344 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLL95_RS13430 (2754734) | 2754734..2755366 | - | 633 | WP_002358972.1 | RloB family protein | - |
OLL95_RS13435 (2755375) | 2755375..2756670 | - | 1296 | WP_010820355.1 | ATP-binding protein | - |
OLL95_RS13440 (2757132) | 2757132..2758748 | + | 1617 | WP_002372620.1 | phosphatase PAP2/LCP family protein | - |
OLL95_RS13445 (2759078) | 2759078..2759227 | + | 150 | WP_002411240.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- (2759160) | 2759160..2759344 | - | 185 | NuclAT_5 | - | Antitoxin |
- (2759201) | 2759201..2759344 | - | 144 | NuclAT_7 | - | - |
OLL95_RS13450 (2759346) | 2759346..2759486 | + | 141 | WP_104875700.1 | putative holin-like toxin | - |
- (2759419) | 2759419..2759620 | - | 202 | NuclAT_4 | - | - |
OLL95_RS13455 (2759717) | 2759717..2759860 | + | 144 | WP_002381035.1 | putative holin-like toxin | - |
- (2760004) | 2760004..2760053 | + | 50 | NuclAT_8 | - | - |
- (2759792) | 2759792..2760054 | - | 263 | NuclAT_6 | - | - |
OLL95_RS13460 (2760055) | 2760055..2762988 | - | 2934 | WP_264547767.1 | WxL domain-containing protein | - |
OLL95_RS13465 (2762975) | 2762975..2763337 | - | 363 | WP_002370158.1 | LPXTG cell wall anchor domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5738.05 Da Isoelectric Point: 11.3858
>T262922 WP_002411240.1 NZ_CP110054:2759078-2759227 [Enterococcus faecalis]
MRMHVFPKFRERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MRMHVFPKFRERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 150 bp
Antitoxin
Download Length: 185 bp
>AT262922 NZ_CP110054:c2759344-2759160 [Enterococcus faecalis]
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTAAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGCGCA
ATCAAAGCAATGGTAAACATACCAA
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTAAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGCGCA
ATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|