Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 343784..343978 | Replicon | chromosome |
| Accession | NZ_CP110054 | ||
| Organism | Enterococcus faecalis strain BE17 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | OLL95_RS01790 | Protein ID | WP_162781186.1 |
| Coordinates | 343883..343978 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 343784..343848 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL95_RS01775 (339403) | 339403..341145 | + | 1743 | WP_002397018.1 | PTS transporter subunit EIIC | - |
| OLL95_RS01780 (341136) | 341136..343169 | + | 2034 | WP_002361171.1 | PRD domain-containing protein | - |
| OLL95_RS01785 (343180) | 343180..343614 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
| - (343784) | 343784..343848 | + | 65 | NuclAT_10 | - | Antitoxin |
| OLL95_RS01790 (343883) | 343883..343978 | - | 96 | WP_162781186.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| OLL95_RS01795 (344224) | 344224..345996 | + | 1773 | WP_025186229.1 | PTS mannitol-specific transporter subunit IIBC | - |
| OLL95_RS01800 (346011) | 346011..346448 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| OLL95_RS01805 (346463) | 346463..347617 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
| OLL95_RS01810 (347686) | 347686..348801 | - | 1116 | WP_002361174.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3658.53 Da Isoelectric Point: 8.6635
>T262915 WP_162781186.1 NZ_CP110054:c343978-343883 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNKE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNKE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT262915 NZ_CP110054:343784-343848 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|