Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
| Location | 41342..41556 | Replicon | plasmid pBE32_1 |
| Accession | NZ_CP110051 | ||
| Organism | Enterococcus faecalis strain BE32 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | OLM04_RS14355 | Protein ID | WP_002360667.1 |
| Coordinates | 41342..41452 (+) | Length | 37 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 41492..41556 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLM04_RS14310 | 36681..37100 | + | 420 | WP_264522698.1 | thioredoxin | - |
| OLM04_RS14315 | 37263..37883 | + | 621 | WP_025188285.1 | recombinase family protein | - |
| OLM04_RS14320 | 37873..38187 | + | 315 | WP_025188489.1 | hypothetical protein | - |
| OLM04_RS14325 | 38181..38405 | + | 225 | WP_002414746.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
| OLM04_RS14330 | 38466..38675 | + | 210 | WP_002399367.1 | hypothetical protein | - |
| OLM04_RS14335 | 38687..38989 | + | 303 | WP_002393766.1 | DUF6440 family protein | - |
| OLM04_RS14340 | 39417..40744 | + | 1328 | Protein_55 | Y-family DNA polymerase | - |
| OLM04_RS14345 | 40741..41091 | + | 351 | WP_010784817.1 | hypothetical protein | - |
| OLM04_RS14350 | 41048..41260 | + | 213 | WP_002406179.1 | hypothetical protein | - |
| OLM04_RS14355 | 41342..41452 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 41492..41556 | - | 65 | - | - | Antitoxin |
| OLM04_RS14360 | 41692..41982 | + | 291 | WP_001137528.1 | hypothetical protein | - |
| OLM04_RS14365 | 42086..42457 | - | 372 | WP_000049959.1 | replication-associated protein RepC | - |
| OLM04_RS14370 | 42450..43295 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..43766 | 43766 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T262893 WP_002360667.1 NZ_CP110051:41342-41452 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
Antitoxin
Download Length: 65 bp
>AT262893 NZ_CP110051:c41556-41492 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|