Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
| Location | 7244..7485 | Replicon | plasmid pBE33_1 |
| Accession | NZ_CP110048 | ||
| Organism | Enterococcus faecalis strain BE33 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | OLL90_RS14140 | Protein ID | WP_002360667.1 |
| Coordinates | 7244..7354 (+) | Length | 37 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 7394..7485 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL90_RS14095 (2478) | 2478..3002 | + | 525 | WP_002360677.1 | hypothetical protein | - |
| OLL90_RS14100 (3165) | 3165..3785 | + | 621 | WP_025188285.1 | recombinase family protein | - |
| OLL90_RS14105 (3775) | 3775..4089 | + | 315 | WP_025188489.1 | hypothetical protein | - |
| OLL90_RS14110 (4083) | 4083..4307 | + | 225 | WP_002414746.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
| OLL90_RS14115 (4368) | 4368..4577 | + | 210 | WP_002399367.1 | hypothetical protein | - |
| OLL90_RS14120 (4589) | 4589..4891 | + | 303 | WP_002393766.1 | DUF6440 family protein | - |
| OLL90_RS14125 (5319) | 5319..6646 | + | 1328 | Protein_8 | Y-family DNA polymerase | - |
| OLL90_RS14130 (6643) | 6643..6993 | + | 351 | WP_010784817.1 | hypothetical protein | - |
| OLL90_RS14135 (6950) | 6950..7162 | + | 213 | WP_002406179.1 | hypothetical protein | - |
| OLL90_RS14140 (7244) | 7244..7354 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - (7394) | 7394..7485 | - | 92 | NuclAT_0 | - | Antitoxin |
| - (7394) | 7394..7485 | - | 92 | NuclAT_0 | - | Antitoxin |
| - (7394) | 7394..7485 | - | 92 | NuclAT_0 | - | Antitoxin |
| - (7394) | 7394..7485 | - | 92 | NuclAT_0 | - | Antitoxin |
| OLL90_RS14145 (7594) | 7594..7884 | + | 291 | WP_001137528.1 | hypothetical protein | - |
| OLL90_RS14150 (7988) | 7988..8359 | - | 372 | WP_000049959.1 | replication-associated protein RepC | - |
| OLL90_RS14155 (8352) | 8352..9197 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
| OLL90_RS14160 (9668) | 9668..10678 | + | 1011 | WP_001058676.1 | replication initiator protein A | - |
| OLL90_RS14165 (10722) | 10722..11705 | + | 984 | WP_000007382.1 | prolipoprotein diacylglyceryl transferase | - |
| OLL90_RS14170 (11630) | 11630..11818 | + | 189 | Protein_17 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..43779 | 43779 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T262872 WP_002360667.1 NZ_CP110048:7244-7354 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
Antitoxin
Download Length: 92 bp
>AT262872 NZ_CP110048:c7485-7394 [Enterococcus faecalis]
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|