Detailed information of TA system TA262870

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): fst-RNAII/Fst(toxin)
• Location: 7244..7458
• Replicon: plasmid pBE33_1
• Accession: NZ_CP110048
• Organism: Enterococcus faecalis strain BE33

Toxin (Protein)

• Gene name: fst
• Uniprot ID: -
• Locus tag: OLL90_RS14140
• Protein ID: WP_002360667.1
• Coordinates: 7244..7354 (+)
• Length: 37 a.a.

Antitoxin (RNA)

Gene name	RNAII
Locus tag	-
Coordinates	7394..7458 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OLL90_RS14095	2478..3002	+	525	WP_002360677.1	hypothetical protein	-
OLL90_RS14100	3165..3785	+	621	WP_025188285.1	recombinase family protein	-
OLL90_RS14105	3775..4089	+	315	WP_025188489.1	hypothetical protein	-
OLL90_RS14110	4083..4307	+	225	WP_002414746.1	ultraviolet resistance protein UvrA repressor UvrC	-
OLL90_RS14115	4368..4577	+	210	WP_002399367.1	hypothetical protein	-
OLL90_RS14120	4589..4891	+	303	WP_002393766.1	DUF6440 family protein	-
OLL90_RS14125	5319..6646	+	1328	Protein_8	Y-family DNA polymerase	-
OLL90_RS14130	6643..6993	+	351	WP_010784817.1	hypothetical protein	-
OLL90_RS14135	6950..7162	+	213	WP_002406179.1	hypothetical protein	-
OLL90_RS14140	7244..7354	+	111	WP_002360667.1	type I toxin-antitoxin system Fst family toxin	Toxin
-	7394..7458	-	65	-	-	Antitoxin
OLL90_RS14145	7594..7884	+	291	WP_001137528.1	hypothetical protein	-
OLL90_RS14150	7988..8359	-	372	WP_000049959.1	replication-associated protein RepC	-
OLL90_RS14155	8352..9197	-	846	WP_000239313.1	AAA family ATPase	-
OLL90_RS14160	9668..10678	+	1011	WP_001058676.1	replication initiator protein A	-
OLL90_RS14165	10722..11705	+	984	WP_000007382.1	prolipoprotein diacylglyceryl transferase	-
OLL90_RS14170	11630..11818	+	189	Protein_17	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	-	-	1..43779	43779

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Sequences

Toxin

Protein

• Length: 37 a.a.
• Molecular weight: 4117.92 Da
• Isoelectric Point: 4.1672

>T262870 WP_002360667.1 NZ_CP110048:7244-7354 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK

Nucleotide

• Length: 111 bp

Antitoxin

Nucleotide

• Length: 65 bp

>AT262870 NZ_CP110048:c7458-7394 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT

Structures

Antitoxin