Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2815557..2815893 | Replicon | chromosome |
Accession | NZ_CP110047 | ||
Organism | Enterococcus faecalis strain BE33 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A125WAU0 |
Locus tag | OLL90_RS13655 | Protein ID | WP_002391551.1 |
Coordinates | 2815557..2815700 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2815844..2815893 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLL90_RS13640 | 2811273..2811905 | - | 633 | WP_002358972.1 | RloB family protein | - |
OLL90_RS13645 | 2811914..2813209 | - | 1296 | WP_002371641.1 | ATP-binding protein | - |
OLL90_RS13650 | 2813671..2815287 | + | 1617 | WP_002365430.1 | phosphatase PAP2/LCP family protein | - |
OLL90_RS13655 | 2815557..2815700 | + | 144 | WP_002391551.1 | putative holin-like toxin | Toxin |
- | 2815844..2815893 | + | 50 | - | - | Antitoxin |
OLL90_RS13660 | 2815895..2820586 | - | 4692 | WP_002399468.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5175.17 Da Isoelectric Point: 8.6389
>T262869 WP_002391551.1 NZ_CP110047:2815557-2815700 [Enterococcus faecalis]
MNVSTKIYEKRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYEKRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT262869 NZ_CP110047:2815844-2815893 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|