Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 317730..317924 | Replicon | chromosome |
| Accession | NZ_CP110047 | ||
| Organism | Enterococcus faecalis strain BE33 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | OLL90_RS01610 | Protein ID | WP_015543884.1 |
| Coordinates | 317829..317924 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 317730..317794 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL90_RS01595 | 313348..315090 | + | 1743 | WP_002391519.1 | PTS transporter subunit EIIC | - |
| OLL90_RS01600 | 315081..317114 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
| OLL90_RS01605 | 317125..317559 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
| - | 317730..317794 | + | 65 | - | - | Antitoxin |
| OLL90_RS01610 | 317829..317924 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| OLL90_RS01615 | 318170..319942 | + | 1773 | WP_002391520.1 | PTS mannitol-specific transporter subunit IIBC | - |
| OLL90_RS01620 | 319957..320394 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| OLL90_RS01625 | 320409..321563 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
| OLL90_RS01630 | 321632..322747 | - | 1116 | WP_002364956.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T262853 WP_015543884.1 NZ_CP110047:c317924-317829 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT262853 NZ_CP110047:317730-317794 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|