Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) fst-RNAII/Fst(toxin)
Location 27945..28177 Replicon plasmid pBE43_2
Accession NZ_CP110043
Organism Enterococcus faecalis strain BE43

Toxin (Protein)


Gene name fst Uniprot ID -
Locus tag OLM01_RS14650 Protein ID WP_002387930.1
Coordinates 27945..28046 (+) Length 34 a.a.

Antitoxin (RNA)


Gene name RNAII
Locus tag -
Coordinates 28086..28177 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLM01_RS14605 (23186) 23186..23473 + 288 WP_010778046.1 hypothetical protein -
OLM01_RS14615 (24776) 24776..25000 + 225 WP_002395938.1 ultraviolet resistance protein UvrA repressor UvrC -
OLM01_RS14620 (25061) 25061..25270 + 210 WP_064686952.1 hypothetical protein -
OLM01_RS14625 (25282) 25282..25455 + 174 WP_002395320.1 hypothetical protein -
OLM01_RS14630 (25473) 25473..25583 + 111 WP_229235047.1 DUF6440 family protein -
OLM01_RS14635 (26010) 26010..27338 + 1329 WP_010717412.1 ultraviolet resistance protein UvrA -
OLM01_RS14640 (27335) 27335..27685 + 351 WP_002395322.1 hypothetical protein -
OLM01_RS14645 (27642) 27642..27854 + 213 WP_002395323.1 hypothetical protein -
OLM01_RS14650 (27945) 27945..28046 + 102 WP_002387930.1 type I toxin-antitoxin system Fst family toxin Toxin
- (28086) 28086..28177 - 92 NuclAT_0 - Antitoxin
- (28086) 28086..28177 - 92 NuclAT_0 - Antitoxin
- (28086) 28086..28177 - 92 NuclAT_0 - Antitoxin
- (28086) 28086..28177 - 92 NuclAT_0 - Antitoxin
OLM01_RS14655 (28287) 28287..28583 + 297 WP_010717413.1 hypothetical protein -
OLM01_RS14660 (28837) 28837..29619 + 783 WP_002369746.1 ParA family protein -
OLM01_RS14665 (29612) 29612..29968 + 357 WP_002360663.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..30227 30227


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 34 a.a.        Molecular weight: 3731.42 Da        Isoelectric Point: 4.1672

>T262850 WP_002387930.1 NZ_CP110043:27945-28046 [Enterococcus faecalis]
VKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK

Download         Length: 102 bp

Antitoxin


Download         Length: 92 bp

>AT262850 NZ_CP110043:c28177-28086 [Enterococcus faecalis]
TAAAAATATGTTATACTATAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References