Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 27945..28177 | Replicon | plasmid pBE43_2 |
Accession | NZ_CP110043 | ||
Organism | Enterococcus faecalis strain BE43 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | OLM01_RS14650 | Protein ID | WP_002387930.1 |
Coordinates | 27945..28046 (+) | Length | 34 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 28086..28177 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM01_RS14605 (23186) | 23186..23473 | + | 288 | WP_010778046.1 | hypothetical protein | - |
OLM01_RS14615 (24776) | 24776..25000 | + | 225 | WP_002395938.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
OLM01_RS14620 (25061) | 25061..25270 | + | 210 | WP_064686952.1 | hypothetical protein | - |
OLM01_RS14625 (25282) | 25282..25455 | + | 174 | WP_002395320.1 | hypothetical protein | - |
OLM01_RS14630 (25473) | 25473..25583 | + | 111 | WP_229235047.1 | DUF6440 family protein | - |
OLM01_RS14635 (26010) | 26010..27338 | + | 1329 | WP_010717412.1 | ultraviolet resistance protein UvrA | - |
OLM01_RS14640 (27335) | 27335..27685 | + | 351 | WP_002395322.1 | hypothetical protein | - |
OLM01_RS14645 (27642) | 27642..27854 | + | 213 | WP_002395323.1 | hypothetical protein | - |
OLM01_RS14650 (27945) | 27945..28046 | + | 102 | WP_002387930.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- (28086) | 28086..28177 | - | 92 | NuclAT_0 | - | Antitoxin |
- (28086) | 28086..28177 | - | 92 | NuclAT_0 | - | Antitoxin |
- (28086) | 28086..28177 | - | 92 | NuclAT_0 | - | Antitoxin |
- (28086) | 28086..28177 | - | 92 | NuclAT_0 | - | Antitoxin |
OLM01_RS14655 (28287) | 28287..28583 | + | 297 | WP_010717413.1 | hypothetical protein | - |
OLM01_RS14660 (28837) | 28837..29619 | + | 783 | WP_002369746.1 | ParA family protein | - |
OLM01_RS14665 (29612) | 29612..29968 | + | 357 | WP_002360663.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..30227 | 30227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 34 a.a. Molecular weight: 3731.42 Da Isoelectric Point: 4.1672
>T262850 WP_002387930.1 NZ_CP110043:27945-28046 [Enterococcus faecalis]
VKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
VKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
Download Length: 102 bp
Antitoxin
Download Length: 92 bp
>AT262850 NZ_CP110043:c28177-28086 [Enterococcus faecalis]
TAAAAATATGTTATACTATAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
TAAAAATATGTTATACTATAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|