Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2651029..2651362 | Replicon | chromosome |
| Accession | NZ_CP110040 | ||
| Organism | Enterococcus faecalis strain BE45 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | OLM07_RS12990 | Protein ID | WP_002415596.1 |
| Coordinates | 2651029..2651172 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2651312..2651362 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLM07_RS12975 (2646684) | 2646684..2647316 | - | 633 | WP_002358972.1 | RloB family protein | - |
| OLM07_RS12980 (2647325) | 2647325..2648620 | - | 1296 | WP_264547459.1 | AAA family ATPase | - |
| OLM07_RS12985 (2649082) | 2649082..2650698 | + | 1617 | WP_002372620.1 | phosphatase PAP2/LCP family protein | - |
| OLM07_RS12990 (2651029) | 2651029..2651172 | + | 144 | WP_002415596.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - (2651105) | 2651105..2651330 | - | 226 | NuclAT_4 | - | - |
| - (2651146) | 2651146..2651330 | - | 185 | NuclAT_6 | - | - |
| - (2651312) | 2651312..2651362 | + | 51 | NuclAT_8 | - | Antitoxin |
| OLM07_RS12995 (2651363) | 2651363..2654833 | - | 3471 | WP_264547460.1 | WxL domain-containing protein | - |
| OLM07_RS13000 (2654890) | 2654890..2656041 | - | 1152 | WP_016632326.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5314.46 Da Isoelectric Point: 10.6323
>T262825 WP_002415596.1 NZ_CP110040:2651029-2651172 [Enterococcus faecalis]
MNVSAKIYERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MNVSAKIYERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 144 bp
Antitoxin
Download Length: 51 bp
>AT262825 NZ_CP110040:2651312-2651362 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATCTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATCTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|