Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-RNAII/- |
Location | 2576275..2576521 | Replicon | chromosome |
Accession | NZ_CP110040 | ||
Organism | Enterococcus faecalis strain BE45 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | OLM07_RS12655 | Protein ID | WP_016630771.1 |
Coordinates | 2576378..2576521 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 2576275..2576404 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM07_RS12640 (2571822) | 2571822..2572535 | - | 714 | WP_002354877.1 | trehalose operon repressor | - |
OLM07_RS12645 (2572797) | 2572797..2575541 | + | 2745 | WP_016630773.1 | glycosyl hydrolase family 65 protein | - |
OLM07_RS12650 (2575556) | 2575556..2576206 | + | 651 | WP_016630772.1 | beta-phosphoglucomutase | - |
- (2576275) | 2576275..2576404 | + | 130 | NuclAT_7 | - | Antitoxin |
- (2576261) | 2576261..2576445 | + | 185 | NuclAT_5 | - | - |
OLM07_RS12655 (2576378) | 2576378..2576521 | - | 144 | WP_016630771.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
OLM07_RS12660 (2576753) | 2576753..2577724 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
OLM07_RS12665 (2577899) | 2577899..2578336 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
OLM07_RS12670 (2578469) | 2578469..2579023 | - | 555 | WP_002354869.1 | Maf family protein | - |
OLM07_RS12675 (2579048) | 2579048..2581090 | - | 2043 | WP_264547450.1 | DNA mismatch repair endonuclease MutL | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5310.47 Da Isoelectric Point: 10.8331
>T262820 WP_016630771.1 NZ_CP110040:c2576521-2576378 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYEKIQTILGFGMFTVALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYEKIQTILGFGMFTVALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 130 bp
>AT262820 NZ_CP110040:2576275-2576404 [Enterococcus faecalis]
TGAAAAGAGAGAGATGCGTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCAATTGTATTATTTAAAAATA
ACCGTACTGGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAAGCAA
TGAAAAGAGAGAGATGCGTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCAATTGTATTATTTAAAAATA
ACCGTACTGGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAAGCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|