Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 324377..324572 | Replicon | chromosome |
Accession | NZ_CP110040 | ||
Organism | Enterococcus faecalis strain BE45 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | OLM07_RS01660 | Protein ID | WP_122975133.1 |
Coordinates | 324477..324572 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 324377..324442 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM07_RS01645 (319989) | 319989..321737 | + | 1749 | WP_016631086.1 | PTS transporter subunit EIIC | - |
OLM07_RS01650 (321728) | 321728..323761 | + | 2034 | WP_016631085.1 | BglG family transcription antiterminator | - |
OLM07_RS01655 (323772) | 323772..324206 | + | 435 | WP_016631084.1 | PTS sugar transporter subunit IIA | - |
- (324377) | 324377..324442 | + | 66 | NuclAT_10 | - | Antitoxin |
OLM07_RS01660 (324477) | 324477..324572 | - | 96 | WP_122975133.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
OLM07_RS01665 (324818) | 324818..326590 | + | 1773 | WP_010821364.1 | PTS mannitol-specific transporter subunit IIBC | - |
OLM07_RS01670 (326605) | 326605..327042 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
OLM07_RS01675 (327057) | 327057..328211 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
OLM07_RS01680 (328279) | 328279..329394 | - | 1116 | WP_016631083.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3645.44 Da Isoelectric Point: 4.5869
>T262815 WP_122975133.1 NZ_CP110040:c324572-324477 [Enterococcus faecalis]
MYDIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYDIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 66 bp
>AT262815 NZ_CP110040:324377-324442 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|