Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-RNAII/- |
Location | 2588055..2588301 | Replicon | chromosome |
Accession | NZ_CP110039 | ||
Organism | Enterococcus faecalis strain BE47 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | OLM03_RS12695 | Protein ID | WP_016630771.1 |
Coordinates | 2588158..2588301 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 2588055..2588184 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM03_RS12680 (2583602) | 2583602..2584315 | - | 714 | WP_002354877.1 | trehalose operon repressor | - |
OLM03_RS12685 (2584577) | 2584577..2587321 | + | 2745 | WP_016630773.1 | glycosyl hydrolase family 65 protein | - |
OLM03_RS12690 (2587336) | 2587336..2587986 | + | 651 | WP_016630772.1 | beta-phosphoglucomutase | - |
- (2588055) | 2588055..2588184 | + | 130 | NuclAT_7 | - | Antitoxin |
- (2588041) | 2588041..2588225 | + | 185 | NuclAT_5 | - | - |
OLM03_RS12695 (2588158) | 2588158..2588301 | - | 144 | WP_016630771.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
OLM03_RS12700 (2588533) | 2588533..2589504 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
OLM03_RS12705 (2589679) | 2589679..2590116 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
OLM03_RS12710 (2590249) | 2590249..2590803 | - | 555 | WP_002354869.1 | Maf family protein | - |
OLM03_RS12715 (2590828) | 2590828..2592870 | - | 2043 | WP_264547450.1 | DNA mismatch repair endonuclease MutL | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5310.47 Da Isoelectric Point: 10.8331
>T262809 WP_016630771.1 NZ_CP110039:c2588301-2588158 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYEKIQTILGFGMFTVALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYEKIQTILGFGMFTVALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 130 bp
>AT262809 NZ_CP110039:2588055-2588184 [Enterococcus faecalis]
TGAAAAGAGAGAGATGCGTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCAATTGTATTATTTAAAAATA
ACCGTACTGGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAAGCAA
TGAAAAGAGAGAGATGCGTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCAATTGTATTATTTAAAAATA
ACCGTACTGGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAAGCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|