Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 324350..324545 | Replicon | chromosome |
Accession | NZ_CP110039 | ||
Organism | Enterococcus faecalis strain BE47 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | OLM03_RS01655 | Protein ID | WP_122975133.1 |
Coordinates | 324450..324545 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 324350..324415 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM03_RS01640 (319962) | 319962..321710 | + | 1749 | WP_016631086.1 | PTS transporter subunit EIIC | - |
OLM03_RS01645 (321701) | 321701..323734 | + | 2034 | WP_016631085.1 | BglG family transcription antiterminator | - |
OLM03_RS01650 (323745) | 323745..324179 | + | 435 | WP_016631084.1 | PTS sugar transporter subunit IIA | - |
- (324350) | 324350..324415 | + | 66 | NuclAT_10 | - | Antitoxin |
OLM03_RS01655 (324450) | 324450..324545 | - | 96 | WP_122975133.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
OLM03_RS01660 (324791) | 324791..326563 | + | 1773 | WP_010821364.1 | PTS mannitol-specific transporter subunit IIBC | - |
OLM03_RS01665 (326578) | 326578..327015 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
OLM03_RS01670 (327030) | 327030..328184 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
OLM03_RS01675 (328252) | 328252..329367 | - | 1116 | WP_016631083.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3645.44 Da Isoelectric Point: 4.5869
>T262804 WP_122975133.1 NZ_CP110039:c324545-324450 [Enterococcus faecalis]
MYDIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYDIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 66 bp
>AT262804 NZ_CP110039:324350-324415 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|