Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 52011..52370 | Replicon | chromosome |
| Accession | NZ_CP110036 | ||
| Organism | Enterococcus faecalis strain BE52 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | OLL99_RS00235 | Protein ID | WP_264526575.1 |
| Coordinates | 52011..52184 (-) | Length | 58 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 52186..52370 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL99_RS00230 | 51669..51812 | - | 144 | WP_073437820.1 | putative holin-like toxin | - |
| OLL99_RS00230 | 51669..51812 | - | 144 | WP_073437820.1 | putative holin-like toxin | - |
| - | 51909..52111 | + | 203 | - | - | - |
| OLL99_RS00235 | 52011..52184 | - | 174 | WP_264526575.1 | putative holin-like toxin | Toxin |
| OLL99_RS00235 | 52011..52184 | - | 174 | WP_264526575.1 | putative holin-like toxin | Toxin |
| - | 52186..52370 | + | 185 | - | - | Antitoxin |
| OLL99_RS00240 | 52303..52452 | - | 150 | WP_002411240.1 | type I toxin-antitoxin system toxin PepG1 | - |
| OLL99_RS00240 | 52303..52452 | - | 150 | WP_002411240.1 | type I toxin-antitoxin system toxin PepG1 | - |
| OLL99_RS00245 | 52781..54397 | - | 1617 | WP_002406969.1 | phosphatase PAP2/LCP family protein | - |
| OLL99_RS00245 | 52781..54397 | - | 1617 | WP_002406969.1 | phosphatase PAP2/LCP family protein | - |
| OLL99_RS00250 | 55083..55721 | + | 639 | WP_073438309.1 | lytic polysaccharide monooxygenase | - |
| OLL99_RS00250 | 55083..55721 | + | 639 | WP_073438309.1 | lytic polysaccharide monooxygenase | - |
| OLL99_RS00255 | 55985..56977 | - | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| OLL99_RS00255 | 55985..56977 | - | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| OLL99_RS00260 | 57116..57331 | + | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| OLL99_RS00260 | 57116..57331 | + | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 58 a.a. Molecular weight: 6615.88 Da Isoelectric Point: 9.7346
>T262788 WP_264526575.1 NZ_CP110036:c52184-52011 [Enterococcus faecalis]
ISLKNTNKNIVYCTTYETIQTILGFGMFTIALIALIVKLLKNDKKKITVYFDQYGYF
ISLKNTNKNIVYCTTYETIQTILGFGMFTIALIALIVKLLKNDKKKITVYFDQYGYF
Download Length: 174 bp
Antitoxin
Download Length: 185 bp
>AT262788 NZ_CP110036:52186-52370 [Enterococcus faecalis]
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTAAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGCGCA
ATCAAAGCAATGGTAAACATACCAA
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTAAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGCGCA
ATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|