Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 2786630..2786824 | Replicon | chromosome |
Accession | NZ_CP110020 | ||
Organism | Enterococcus faecalis strain BE69 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | OLM05_RS13400 | Protein ID | WP_015543884.1 |
Coordinates | 2786630..2786725 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 2786760..2786824 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM05_RS13380 (2781806) | 2781806..2782921 | + | 1116 | WP_002383680.1 | FAD-dependent oxidoreductase | - |
OLM05_RS13385 (2782990) | 2782990..2784144 | - | 1155 | WP_002383679.1 | mannitol-1-phosphate 5-dehydrogenase | - |
OLM05_RS13390 (2784159) | 2784159..2784596 | - | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
OLM05_RS13395 (2784611) | 2784611..2786383 | - | 1773 | WP_010715007.1 | PTS mannitol-specific transporter subunit IIBC | - |
OLM05_RS13400 (2786630) | 2786630..2786725 | + | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- (2786760) | 2786760..2786824 | - | 65 | NuclAT_13 | - | Antitoxin |
OLM05_RS13405 (2786995) | 2786995..2787429 | - | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
OLM05_RS13410 (2787440) | 2787440..2789473 | - | 2034 | WP_002383677.1 | BglG family transcription antiterminator | - |
OLM05_RS13415 (2789464) | 2789464..2791212 | - | 1749 | WP_002383675.1 | PTS transporter subunit EIIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T262780 WP_015543884.1 NZ_CP110020:2786630-2786725 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T262780 NZ_CP110020:2786630-2786725 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT262780 NZ_CP110020:c2786824-2786760 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|