Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 382846..383244 | Replicon | chromosome |
Accession | NZ_CP110020 | ||
Organism | Enterococcus faecalis strain BE69 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | OLM05_RS01845 | Protein ID | WP_227330998.1 |
Coordinates | 383140..383244 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 382846..382988 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM05_RS01820 (379492) | 379492..380046 | + | 555 | WP_002383211.1 | nucleoside triphosphate pyrophosphatase | - |
OLM05_RS01825 (380179) | 380179..380616 | + | 438 | WP_010715474.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
OLM05_RS01830 (380791) | 380791..381762 | + | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
OLM05_RS01835 (381948) | 381948..382349 | - | 402 | WP_002383213.1 | hypothetical protein | - |
OLM05_RS01840 (382633) | 382633..382758 | + | 126 | WP_002383214.1 | hypothetical protein | - |
- (382846) | 382846..382988 | - | 143 | NuclAT_11 | - | Antitoxin |
OLM05_RS01845 (383140) | 383140..383244 | + | 105 | WP_227330998.1 | putative holin-like toxin | Toxin |
- (383177) | 383177..383364 | - | 188 | NuclAT_5 | - | - |
- (383406) | 383406..383520 | - | 115 | NuclAT_12 | - | - |
OLM05_RS01850 (383549) | 383549..384199 | - | 651 | WP_002383215.1 | beta-phosphoglucomutase | - |
OLM05_RS01855 (384214) | 384214..386958 | - | 2745 | WP_002383216.1 | glycosyl hydrolase family 65 protein | - |
OLM05_RS01860 (387219) | 387219..387932 | + | 714 | WP_002354877.1 | trehalose operon repressor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3827.68 Da Isoelectric Point: 10.0079
>T262771 WP_227330998.1 NZ_CP110020:383140-383244 [Enterococcus faecalis]
MSAYETIQTILGFGMFTIALIVLIVKLLKNDNKK
MSAYETIQTILGFGMFTIALIVLIVKLLKNDNKK
Download Length: 105 bp
Antitoxin
Download Length: 143 bp
>AT262771 NZ_CP110020:c382988-382846 [Enterococcus faecalis]
TGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACCGATCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAACA
TGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACCGATCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAACA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|