Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2495711..2496109 | Replicon | chromosome |
Accession | NZ_CP110019 | ||
Organism | Enterococcus faecalis strain BE70 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | OLM00_RS12105 | Protein ID | WP_227330998.1 |
Coordinates | 2495711..2495815 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2495967..2496109 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM00_RS12090 (2491023) | 2491023..2491736 | - | 714 | WP_002354877.1 | trehalose operon repressor | - |
OLM00_RS12095 (2491997) | 2491997..2494741 | + | 2745 | WP_002383216.1 | glycosyl hydrolase family 65 protein | - |
OLM00_RS12100 (2494756) | 2494756..2495406 | + | 651 | WP_002383215.1 | beta-phosphoglucomutase | - |
- (2495435) | 2495435..2495549 | + | 115 | NuclAT_12 | - | - |
- (2495591) | 2495591..2495778 | + | 188 | NuclAT_5 | - | - |
OLM00_RS12105 (2495711) | 2495711..2495815 | - | 105 | WP_227330998.1 | putative holin-like toxin | Toxin |
- (2495967) | 2495967..2496109 | + | 143 | NuclAT_11 | - | Antitoxin |
OLM00_RS12110 (2496197) | 2496197..2496322 | - | 126 | WP_002383214.1 | hypothetical protein | - |
OLM00_RS12115 (2496606) | 2496606..2497139 | + | 534 | WP_002416003.1 | CPBP family intramembrane metalloprotease | - |
OLM00_RS12120 (2497192) | 2497192..2498163 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
OLM00_RS12125 (2498338) | 2498338..2498775 | - | 438 | WP_010715474.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
OLM00_RS12130 (2498908) | 2498908..2499463 | - | 556 | Protein_2357 | Maf family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3827.68 Da Isoelectric Point: 10.0079
>T262770 WP_227330998.1 NZ_CP110019:c2495815-2495711 [Enterococcus faecalis]
MSAYETIQTILGFGMFTIALIVLIVKLLKNDNKK
MSAYETIQTILGFGMFTIALIVLIVKLLKNDNKK
Download Length: 105 bp
Antitoxin
Download Length: 143 bp
>AT262770 NZ_CP110019:2495967-2496109 [Enterococcus faecalis]
TGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACCGATCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAACA
TGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACCGATCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAACA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|