Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 94206..94400 | Replicon | chromosome |
Accession | NZ_CP110019 | ||
Organism | Enterococcus faecalis strain BE70 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | OLM00_RS00540 | Protein ID | WP_015543884.1 |
Coordinates | 94305..94400 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 94206..94270 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM00_RS00525 (89833) | 89833..91566 | + | 1734 | WP_079995687.1 | PTS transporter subunit EIIC | - |
OLM00_RS00530 (91557) | 91557..93590 | + | 2034 | WP_002383677.1 | BglG family transcription antiterminator | - |
OLM00_RS00535 (93601) | 93601..94035 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
- (94206) | 94206..94270 | + | 65 | NuclAT_13 | - | Antitoxin |
OLM00_RS00540 (94305) | 94305..94400 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
OLM00_RS00545 (94646) | 94646..96418 | + | 1773 | WP_010715007.1 | PTS mannitol-specific transporter subunit IIBC | - |
OLM00_RS00550 (96433) | 96433..96870 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
OLM00_RS00555 (96885) | 96885..98039 | + | 1155 | WP_002383679.1 | mannitol-1-phosphate 5-dehydrogenase | - |
OLM00_RS00560 (98108) | 98108..99223 | - | 1116 | WP_002383680.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T262762 WP_015543884.1 NZ_CP110019:c94400-94305 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT262762 NZ_CP110019:94206-94270 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|