Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 3264967..3265660 | Replicon | chromosome |
Accession | NZ_CP110018 | ||
Organism | Escherichia coli strain DH10B |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | OLR78_RS16080 | Protein ID | WP_000415584.1 |
Coordinates | 3265364..3265660 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | OLR78_RS16075 | Protein ID | WP_000650107.1 |
Coordinates | 3264967..3265362 (-) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR78_RS16065 (3260831) | 3260831..3263089 | - | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
OLR78_RS16070 (3263227) | 3263227..3264834 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
OLR78_RS16075 (3264967) | 3264967..3265362 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
OLR78_RS16080 (3265364) | 3265364..3265660 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
OLR78_RS16085 (3265865) | 3265865..3266347 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
OLR78_RS16090 (3266400) | 3266400..3266792 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
OLR78_RS16095 (3266944) | 3266944..3267603 | + | 660 | WP_001221495.1 | quorum sensing response regulator transcription factor QseB | - |
OLR78_RS16100 (3267600) | 3267600..3268949 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
OLR78_RS16105 (3268995) | 3268995..3269327 | - | 333 | WP_000917684.1 | DUF2645 family protein | - |
OLR78_RS16110 (3269646) | 3269646..3270227 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
OLR78_RS16115 (3270258) | 3270258..3270572 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T262756 WP_000415584.1 NZ_CP110018:c3265660-3265364 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT262756 WP_000650107.1 NZ_CP110018:c3265362-3264967 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|