Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 3264963..3265656 | Replicon | chromosome |
Accession | NZ_CP110017 | ||
Organism | Escherichia coli strain HE_50 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | OLR76_RS16080 | Protein ID | WP_282983233.1 |
Coordinates | 3265360..3265656 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | OLR76_RS16075 | Protein ID | WP_000650107.1 |
Coordinates | 3264963..3265358 (-) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR76_RS16065 (3260827) | 3260827..3263085 | - | 2259 | WP_255784241.1 | DNA topoisomerase IV subunit A | - |
OLR76_RS16070 (3263223) | 3263223..3264830 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
OLR76_RS16075 (3264963) | 3264963..3265358 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
OLR76_RS16080 (3265360) | 3265360..3265656 | - | 297 | WP_282983233.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
OLR76_RS16085 (3265861) | 3265861..3266343 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
OLR76_RS16090 (3266396) | 3266396..3266788 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
OLR76_RS16095 (3266940) | 3266940..3267599 | + | 660 | WP_001221495.1 | quorum sensing response regulator transcription factor QseB | - |
OLR76_RS16100 (3267596) | 3267596..3268945 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
OLR76_RS16105 (3268991) | 3268991..3269323 | - | 333 | WP_000917684.1 | DUF2645 family protein | - |
OLR76_RS16110 (3269642) | 3269642..3270223 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
OLR76_RS16115 (3270254) | 3270254..3270568 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11245.99 Da Isoelectric Point: 8.9070
>T262730 WP_282983233.1 NZ_CP110017:c3265656-3265360 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSEHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSEHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT262730 WP_000650107.1 NZ_CP110017:c3265358-3264963 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|