Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 226109..226803 | Replicon | chromosome |
Accession | NZ_CP110017 | ||
Organism | Escherichia coli strain HE_50 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | OLR76_RS01080 | Protein ID | WP_001263489.1 |
Coordinates | 226405..226803 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | OLR76_RS01075 | Protein ID | WP_000554758.1 |
Coordinates | 226109..226402 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR76_RS01055 (221742) | 221742..222239 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
OLR76_RS01060 (222463) | 222463..224175 | - | 1713 | Protein_204 | flagellar biosynthesis protein FlhA | - |
OLR76_RS01065 (224147) | 224147..224932 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
OLR76_RS01070 (225003) | 225003..226057 | + | 1055 | Protein_206 | DNA polymerase IV | - |
OLR76_RS01075 (226109) | 226109..226402 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
OLR76_RS01080 (226405) | 226405..226803 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
OLR76_RS01085 (226813) | 226813..227265 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
OLR76_RS01090 (227583) | 227583..227789 | + | 207 | Protein_210 | RtcB family protein | - |
OLR76_RS01095 (227785) | 227785..228306 | + | 522 | Protein_211 | peptide chain release factor H | - |
OLR76_RS01100 (228363) | 228363..229820 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
OLR76_RS01105 (230081) | 230081..230539 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- (231135) | 231135..231215 | + | 81 | NuclAT_12 | - | - |
- (231135) | 231135..231215 | + | 81 | NuclAT_12 | - | - |
- (231135) | 231135..231215 | + | 81 | NuclAT_12 | - | - |
- (231135) | 231135..231215 | + | 81 | NuclAT_12 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T262711 WP_001263489.1 NZ_CP110017:226405-226803 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |