Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 226110..226804 | Replicon | chromosome |
Accession | NZ_CP110016 | ||
Organism | Escherichia coli strain HE_100 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | OLR74_RS01080 | Protein ID | WP_001263489.1 |
Coordinates | 226406..226804 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | OLR74_RS01075 | Protein ID | WP_000554758.1 |
Coordinates | 226110..226403 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR74_RS01055 (221743) | 221743..222240 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
OLR74_RS01060 (222464) | 222464..224176 | - | 1713 | Protein_204 | flagellar biosynthesis protein FlhA | - |
OLR74_RS01065 (224148) | 224148..224933 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
OLR74_RS01070 (225004) | 225004..226058 | + | 1055 | Protein_206 | DNA polymerase IV | - |
OLR74_RS01075 (226110) | 226110..226403 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
OLR74_RS01080 (226406) | 226406..226804 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
OLR74_RS01085 (226814) | 226814..227266 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
OLR74_RS01090 (227584) | 227584..227790 | + | 207 | Protein_210 | RtcB family protein | - |
OLR74_RS01095 (227786) | 227786..228307 | + | 522 | Protein_211 | peptide chain release factor H | - |
OLR74_RS01100 (228364) | 228364..229821 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
OLR74_RS01105 (230082) | 230082..230540 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- (231136) | 231136..231216 | + | 81 | NuclAT_12 | - | - |
- (231136) | 231136..231216 | + | 81 | NuclAT_12 | - | - |
- (231136) | 231136..231216 | + | 81 | NuclAT_12 | - | - |
- (231136) | 231136..231216 | + | 81 | NuclAT_12 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T262685 WP_001263489.1 NZ_CP110016:226406-226804 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |