Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 3264962..3265655 | Replicon | chromosome |
| Accession | NZ_CP110015 | ||
| Organism | Escherichia coli strain HE_150 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | - |
| Locus tag | OLR73_RS16075 | Protein ID | WP_282983233.1 |
| Coordinates | 3265359..3265655 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | OLR73_RS16070 | Protein ID | WP_000650107.1 |
| Coordinates | 3264962..3265357 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLR73_RS16060 (3260826) | 3260826..3263084 | - | 2259 | WP_255784241.1 | DNA topoisomerase IV subunit A | - |
| OLR73_RS16065 (3263222) | 3263222..3264829 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| OLR73_RS16070 (3264962) | 3264962..3265357 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| OLR73_RS16075 (3265359) | 3265359..3265655 | - | 297 | WP_282983233.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| OLR73_RS16080 (3265860) | 3265860..3266342 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| OLR73_RS16085 (3266395) | 3266395..3266787 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| OLR73_RS16090 (3266939) | 3266939..3267598 | + | 660 | WP_001221495.1 | quorum sensing response regulator transcription factor QseB | - |
| OLR73_RS16095 (3267595) | 3267595..3268944 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
| OLR73_RS16100 (3268990) | 3268990..3269322 | - | 333 | WP_000917684.1 | DUF2645 family protein | - |
| OLR73_RS16105 (3269641) | 3269641..3270222 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| OLR73_RS16110 (3270253) | 3270253..3270567 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11245.99 Da Isoelectric Point: 8.9070
>T262678 WP_282983233.1 NZ_CP110015:c3265655-3265359 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSEHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSEHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT262678 WP_000650107.1 NZ_CP110015:c3265357-3264962 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|