Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 3264955..3265648 | Replicon | chromosome |
Accession | NZ_CP110014 | ||
Organism | Escherichia coli strain HE_100-10 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | OLR77_RS16085 | Protein ID | WP_282983233.1 |
Coordinates | 3265352..3265648 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | OLR77_RS16080 | Protein ID | WP_000650107.1 |
Coordinates | 3264955..3265350 (-) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR77_RS16070 (3260819) | 3260819..3263077 | - | 2259 | WP_255784241.1 | DNA topoisomerase IV subunit A | - |
OLR77_RS16075 (3263215) | 3263215..3264822 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
OLR77_RS16080 (3264955) | 3264955..3265350 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
OLR77_RS16085 (3265352) | 3265352..3265648 | - | 297 | WP_282983233.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
OLR77_RS16090 (3265853) | 3265853..3266335 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
OLR77_RS16095 (3266388) | 3266388..3266780 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
OLR77_RS16100 (3266932) | 3266932..3267591 | + | 660 | WP_001221495.1 | quorum sensing response regulator transcription factor QseB | - |
OLR77_RS16105 (3267588) | 3267588..3268937 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
OLR77_RS16110 (3268983) | 3268983..3269315 | - | 333 | WP_000917684.1 | DUF2645 family protein | - |
OLR77_RS16115 (3269634) | 3269634..3270215 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
OLR77_RS16120 (3270246) | 3270246..3270560 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11245.99 Da Isoelectric Point: 8.9070
>T262652 WP_282983233.1 NZ_CP110014:c3265648-3265352 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSEHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSEHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT262652 WP_000650107.1 NZ_CP110014:c3265350-3264955 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|