Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 42189..42913 Replicon plasmid pKP424-5
Accession NZ_CP109987
Organism Klebsiella pneumoniae strain KP424

Toxin (Protein)


Gene name higB Uniprot ID A0A2J4YLV3
Locus tag OJ961_RS29345 Protein ID WP_023292165.1
Coordinates 42189..42500 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A7G3NP42
Locus tag OJ961_RS29350 Protein ID WP_023317816.1
Coordinates 42497..42913 (+) Length 139 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OJ961_RS29300 (OJ961_29305) 37402..37833 + 432 WP_004152657.1 conjugation system SOS inhibitor PsiB -
OJ961_RS29305 (OJ961_29310) 37830..38552 + 723 WP_022631512.1 plasmid SOS inhibition protein A -
OJ961_RS29310 (OJ961_29315) 38556..38879 + 324 WP_004199367.1 hypothetical protein -
OJ961_RS29315 (OJ961_29320) 38990..39364 + 375 WP_050584024.1 hypothetical protein -
OJ961_RS29320 (OJ961_29325) 39440..39736 + 297 WP_023317812.1 hypothetical protein -
OJ961_RS29325 (OJ961_29330) 40392..40664 + 273 WP_023317813.1 hypothetical protein -
OJ961_RS29330 (OJ961_29335) 40661..41011 + 351 WP_104513727.1 hypothetical protein -
OJ961_RS29335 (OJ961_29340) 41641..41847 + 207 WP_023317814.1 hypothetical protein -
OJ961_RS29340 (OJ961_29345) 41858..42082 + 225 WP_023317815.1 hypothetical protein -
OJ961_RS29345 (OJ961_29350) 42189..42500 + 312 WP_023292165.1 type II toxin-antitoxin system HigB family toxin Toxin
OJ961_RS29350 (OJ961_29355) 42497..42913 + 417 WP_023317816.1 helix-turn-helix domain-containing protein Antitoxin
OJ961_RS29355 (OJ961_29360) 43748..44101 + 354 WP_023317817.1 hypothetical protein -
OJ961_RS29360 (OJ961_29365) 44158..44505 + 348 WP_023317818.1 hypothetical protein -
OJ961_RS29365 (OJ961_29370) 44600..44746 + 147 WP_004152750.1 hypothetical protein -
OJ961_RS29370 (OJ961_29375) 44796..45629 + 834 WP_023317819.1 N-6 DNA methylase -
OJ961_RS29375 (OJ961_29380) 46447..47268 + 822 WP_023317820.1 DUF932 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..81442 81442


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Antitoxin HigA

(5-138)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12497.32 Da        Isoelectric Point: 9.9242

>T262627 WP_023292165.1 NZ_CP109987:42189-42500 [Klebsiella pneumoniae]
VHVISRAPFDEAARHYPNDAAAIDDTYRVLKRVVAKKPDELKRYFTSLDRMKYREKWWVIDIGGNNLRMMFFADFERGKI
FVKHITTHAEYDRLTKYYREHKE

Download         Length: 312 bp

Antitoxin


Download         Length: 139 a.a.        Molecular weight: 15458.60 Da        Isoelectric Point: 4.4803

>AT262627 WP_023317816.1 NZ_CP109987:42497-42913 [Klebsiella pneumoniae]
MIFSDAIKAANDLASIVPLLGGSSSRKDYEEALKLVEYLLEHEPDSPLVDMLTARIDAWEDTAVEFEEFNTRIEAGKNGV
SLLRVLMQQRGLSQSDFENEIGKKSLVSRILSGERSLTLDHMRALANRFQIPVSMFVD

Download         Length: 417 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4YLV3

Antitoxin

Source ID Structure
AlphaFold DB A0A7G3NP42

References