Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 42189..42913 | Replicon | plasmid pKP424-5 |
Accession | NZ_CP109987 | ||
Organism | Klebsiella pneumoniae strain KP424 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A2J4YLV3 |
Locus tag | OJ961_RS29345 | Protein ID | WP_023292165.1 |
Coordinates | 42189..42500 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A7G3NP42 |
Locus tag | OJ961_RS29350 | Protein ID | WP_023317816.1 |
Coordinates | 42497..42913 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OJ961_RS29300 (OJ961_29305) | 37402..37833 | + | 432 | WP_004152657.1 | conjugation system SOS inhibitor PsiB | - |
OJ961_RS29305 (OJ961_29310) | 37830..38552 | + | 723 | WP_022631512.1 | plasmid SOS inhibition protein A | - |
OJ961_RS29310 (OJ961_29315) | 38556..38879 | + | 324 | WP_004199367.1 | hypothetical protein | - |
OJ961_RS29315 (OJ961_29320) | 38990..39364 | + | 375 | WP_050584024.1 | hypothetical protein | - |
OJ961_RS29320 (OJ961_29325) | 39440..39736 | + | 297 | WP_023317812.1 | hypothetical protein | - |
OJ961_RS29325 (OJ961_29330) | 40392..40664 | + | 273 | WP_023317813.1 | hypothetical protein | - |
OJ961_RS29330 (OJ961_29335) | 40661..41011 | + | 351 | WP_104513727.1 | hypothetical protein | - |
OJ961_RS29335 (OJ961_29340) | 41641..41847 | + | 207 | WP_023317814.1 | hypothetical protein | - |
OJ961_RS29340 (OJ961_29345) | 41858..42082 | + | 225 | WP_023317815.1 | hypothetical protein | - |
OJ961_RS29345 (OJ961_29350) | 42189..42500 | + | 312 | WP_023292165.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
OJ961_RS29350 (OJ961_29355) | 42497..42913 | + | 417 | WP_023317816.1 | helix-turn-helix domain-containing protein | Antitoxin |
OJ961_RS29355 (OJ961_29360) | 43748..44101 | + | 354 | WP_023317817.1 | hypothetical protein | - |
OJ961_RS29360 (OJ961_29365) | 44158..44505 | + | 348 | WP_023317818.1 | hypothetical protein | - |
OJ961_RS29365 (OJ961_29370) | 44600..44746 | + | 147 | WP_004152750.1 | hypothetical protein | - |
OJ961_RS29370 (OJ961_29375) | 44796..45629 | + | 834 | WP_023317819.1 | N-6 DNA methylase | - |
OJ961_RS29375 (OJ961_29380) | 46447..47268 | + | 822 | WP_023317820.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..81442 | 81442 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12497.32 Da Isoelectric Point: 9.9242
>T262627 WP_023292165.1 NZ_CP109987:42189-42500 [Klebsiella pneumoniae]
VHVISRAPFDEAARHYPNDAAAIDDTYRVLKRVVAKKPDELKRYFTSLDRMKYREKWWVIDIGGNNLRMMFFADFERGKI
FVKHITTHAEYDRLTKYYREHKE
VHVISRAPFDEAARHYPNDAAAIDDTYRVLKRVVAKKPDELKRYFTSLDRMKYREKWWVIDIGGNNLRMMFFADFERGKI
FVKHITTHAEYDRLTKYYREHKE
Download Length: 312 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15458.60 Da Isoelectric Point: 4.4803
>AT262627 WP_023317816.1 NZ_CP109987:42497-42913 [Klebsiella pneumoniae]
MIFSDAIKAANDLASIVPLLGGSSSRKDYEEALKLVEYLLEHEPDSPLVDMLTARIDAWEDTAVEFEEFNTRIEAGKNGV
SLLRVLMQQRGLSQSDFENEIGKKSLVSRILSGERSLTLDHMRALANRFQIPVSMFVD
MIFSDAIKAANDLASIVPLLGGSSSRKDYEEALKLVEYLLEHEPDSPLVDMLTARIDAWEDTAVEFEEFNTRIEAGKNGV
SLLRVLMQQRGLSQSDFENEIGKKSLVSRILSGERSLTLDHMRALANRFQIPVSMFVD
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4YLV3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7G3NP42 |