Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 327943..328529 | Replicon | chromosome |
| Accession | NZ_CP109983 | ||
| Organism | Klebsiella pneumoniae strain KP424 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | W8VD46 |
| Locus tag | OJ961_RS01535 | Protein ID | WP_002920800.1 |
| Coordinates | 328161..328529 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | W9B1V1 |
| Locus tag | OJ961_RS01530 | Protein ID | WP_004174006.1 |
| Coordinates | 327943..328164 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OJ961_RS01510 (324100) | 324100..325026 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| OJ961_RS01515 (325023) | 325023..326300 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
| OJ961_RS01520 (326297) | 326297..327064 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| OJ961_RS01525 (327066) | 327066..327779 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| OJ961_RS01530 (327943) | 327943..328164 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OJ961_RS01535 (328161) | 328161..328529 | + | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| OJ961_RS01540 (328802) | 328802..330118 | + | 1317 | WP_004174008.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| OJ961_RS01545 (330225) | 330225..331112 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| OJ961_RS01550 (331109) | 331109..331954 | + | 846 | WP_004181473.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| OJ961_RS01555 (331956) | 331956..333026 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 325023..333763 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T262603 WP_002920800.1 NZ_CP109983:328161-328529 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GUD1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E5YJY7 |