Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 161529..161782 | Replicon | plasmid pB |
| Accession | NZ_CP109975 | ||
| Organism | Klebsiella pneumoniae strain 857 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OI501_RS28935 | Protein ID | WP_001312851.1 |
| Coordinates | 161633..161782 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 161529..161588 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI501_RS28895 (156911) | 156911..157255 | - | 345 | Protein_193 | IS6-like element IS26 family transposase | - |
| OI501_RS28900 (157307) | 157307..158011 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OI501_RS28905 (158036) | 158036..158236 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| OI501_RS28910 (158256) | 158256..159002 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OI501_RS28915 (159057) | 159057..159617 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OI501_RS28920 (159749) | 159749..159949 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| OI501_RS28925 (160335) | 160335..160934 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OI501_RS28930 (160996) | 160996..161328 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (161529) | 161529..161588 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (161529) | 161529..161588 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (161529) | 161529..161588 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (161529) | 161529..161588 | - | 60 | NuclAT_1 | - | Antitoxin |
| OI501_RS28935 (161633) | 161633..161782 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| OI501_RS28940 (162066) | 162066..162314 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OI501_RS28945 (162429) | 162429..162613 | + | 185 | Protein_203 | protein CopA/IncA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / tet(A) / catA2 / sul2 | - | 1..162625 | 162625 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T262599 WP_001312851.1 NZ_CP109975:161633-161782 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT262599 NZ_CP109975:c161588-161529 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
