Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 35049..35318 | Replicon | plasmid pB |
Accession | NZ_CP109975 | ||
Organism | Klebsiella pneumoniae strain 857 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | OI501_RS28165 | Protein ID | WP_001372321.1 |
Coordinates | 35193..35318 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 35049..35114 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI501_RS28135 | 30759..31286 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
OI501_RS28140 | 31344..31577 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
OI501_RS28145 | 31638..33661 | + | 2024 | Protein_43 | ParB/RepB/Spo0J family partition protein | - |
OI501_RS28150 | 33730..34164 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
OI501_RS28155 | 34161..34880 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 34892..35116 | + | 225 | NuclAT_0 | - | - |
- | 34892..35116 | + | 225 | NuclAT_0 | - | - |
- | 34892..35116 | + | 225 | NuclAT_0 | - | - |
- | 34892..35116 | + | 225 | NuclAT_0 | - | - |
- | 35049..35114 | - | 66 | - | - | Antitoxin |
OI501_RS28160 | 35102..35251 | + | 150 | Protein_46 | plasmid maintenance protein Mok | - |
OI501_RS28165 | 35193..35318 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
OI501_RS28170 | 35637..35933 | - | 297 | Protein_48 | hypothetical protein | - |
OI501_RS28175 | 36233..36529 | + | 297 | WP_001272251.1 | hypothetical protein | - |
OI501_RS28180 | 36640..37461 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
OI501_RS28185 | 37758..38405 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
OI501_RS28190 | 38682..39065 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
OI501_RS28195 | 39346..40050 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / tet(A) / catA2 / sul2 | - | 1..162625 | 162625 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T262597 WP_001372321.1 NZ_CP109975:35193-35318 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT262597 NZ_CP109975:c35114-35049 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|