Detailed information of TA system TA262597

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 35049..35318
• Replicon: plasmid pB
• Accession: NZ_CP109975
• Organism: Klebsiella pneumoniae strain 857

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OI501_RS28165
• Protein ID: WP_001372321.1
• Coordinates: 35193..35318 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	35049..35114 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OI501_RS28135	30759..31286	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
OI501_RS28140	31344..31577	+	234	WP_000006003.1	DUF905 family protein	-
OI501_RS28145	31638..33661	+	2024	Protein_43	ParB/RepB/Spo0J family partition protein	-
OI501_RS28150	33730..34164	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
OI501_RS28155	34161..34880	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	34892..35116	+	225	NuclAT_0	-	-
-	34892..35116	+	225	NuclAT_0	-	-
-	34892..35116	+	225	NuclAT_0	-	-
-	34892..35116	+	225	NuclAT_0	-	-
-	35049..35114	-	66	-	-	Antitoxin
OI501_RS28160	35102..35251	+	150	Protein_46	plasmid maintenance protein Mok	-
OI501_RS28165	35193..35318	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
OI501_RS28170	35637..35933	-	297	Protein_48	hypothetical protein	-
OI501_RS28175	36233..36529	+	297	WP_001272251.1	hypothetical protein	-
OI501_RS28180	36640..37461	+	822	WP_001234445.1	DUF932 domain-containing protein	-
OI501_RS28185	37758..38405	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
OI501_RS28190	38682..39065	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
OI501_RS28195	39346..40050	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / tet(A) / catA2 / sul2	-	1..162625	162625

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T262597 WP_001372321.1 NZ_CP109975:35193-35318 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT262597 NZ_CP109975:c35114-35049 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin