Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 747762..748537 | Replicon | chromosome |
Accession | NZ_CP109973 | ||
Organism | Klebsiella pneumoniae strain 857 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | OI501_RS03740 | Protein ID | WP_004150910.1 |
Coordinates | 748052..748537 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | OI501_RS03735 | Protein ID | WP_004150912.1 |
Coordinates | 747762..748055 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI501_RS03715 (OI501_03715) | 742970..743572 | - | 603 | WP_062954968.1 | short chain dehydrogenase | - |
OI501_RS03720 (OI501_03720) | 743670..744581 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
OI501_RS03725 (OI501_03725) | 744582..745730 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
OI501_RS03730 (OI501_03730) | 745741..747117 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
OI501_RS03735 (OI501_03735) | 747762..748055 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
OI501_RS03740 (OI501_03740) | 748052..748537 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
OI501_RS03745 (OI501_03745) | 749241..749834 | + | 594 | WP_004188553.1 | hypothetical protein | - |
OI501_RS03750 (OI501_03750) | 749931..750147 | + | 217 | Protein_737 | transposase | - |
OI501_RS03755 (OI501_03755) | 750753..751625 | + | 873 | WP_004188557.1 | ParA family protein | - |
OI501_RS03760 (OI501_03760) | 751625..752008 | + | 384 | WP_004150906.1 | hypothetical protein | - |
OI501_RS03765 (OI501_03765) | 752001..753368 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 749931..750083 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T262579 WP_004150910.1 NZ_CP109973:748052-748537 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |