Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 31284..31941 | Replicon | plasmid pNY13307-1 |
| Accession | NZ_CP109964 | ||
| Organism | Klebsiella pneumoniae isolate NY13307 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U3PDC3 |
| Locus tag | OJ970_RS25650 | Protein ID | WP_000270043.1 |
| Coordinates | 31284..31634 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OJ970_RS25655 | Protein ID | WP_000124640.1 |
| Coordinates | 31639..31941 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OJ970_RS25605 (OJ970_25610) | 26595..26774 | + | 180 | Protein_37 | helix-turn-helix domain-containing protein | - |
| OJ970_RS25610 (OJ970_25615) | 26839..27543 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OJ970_RS25615 (OJ970_25620) | 27758..28255 | - | 498 | WP_000062185.1 | hypothetical protein | - |
| OJ970_RS25620 (OJ970_25625) | 28258..28746 | - | 489 | WP_001273096.1 | DUF1643 domain-containing protein | - |
| OJ970_RS25625 (OJ970_25630) | 28843..29178 | + | 336 | WP_000683476.1 | hypothetical protein | - |
| OJ970_RS25630 (OJ970_25635) | 29193..29663 | - | 471 | WP_001281821.1 | hypothetical protein | - |
| OJ970_RS25635 (OJ970_25640) | 29656..30027 | - | 372 | WP_000516916.1 | hypothetical protein | - |
| OJ970_RS25640 (OJ970_25645) | 30038..30232 | - | 195 | WP_000343597.1 | hypothetical protein | - |
| OJ970_RS25645 (OJ970_25650) | 30573..31121 | - | 549 | WP_001061574.1 | transcriptional regulator | - |
| OJ970_RS25650 (OJ970_25655) | 31284..31634 | + | 351 | WP_000270043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OJ970_RS25655 (OJ970_25660) | 31639..31941 | + | 303 | WP_000124640.1 | XRE family transcriptional regulator | Antitoxin |
| OJ970_RS25660 (OJ970_25665) | 31968..32261 | - | 294 | WP_001239997.1 | chromosome segregation protein ParM | - |
| OJ970_RS25665 (OJ970_25670) | 32349..32621 | - | 273 | WP_001043047.1 | HU family DNA-binding protein | - |
| OJ970_RS25670 (OJ970_25675) | 32679..33206 | - | 528 | WP_001236377.1 | thermonuclease family protein | - |
| OJ970_RS25675 (OJ970_25680) | 33437..34294 | - | 858 | WP_001167032.1 | hypothetical protein | - |
| OJ970_RS25680 (OJ970_25685) | 34281..34511 | - | 231 | WP_000972663.1 | hypothetical protein | - |
| OJ970_RS25685 (OJ970_25690) | 34511..35029 | - | 519 | WP_000210756.1 | nitrite reductase | - |
| OJ970_RS25690 (OJ970_25695) | 35026..35472 | - | 447 | WP_000919345.1 | Fe3+-siderophore ABC transporter permease | - |
| OJ970_RS25695 (OJ970_25700) | 35472..35831 | - | 360 | WP_000422768.1 | hypothetical protein | - |
| OJ970_RS25700 (OJ970_25705) | 35888..36316 | - | 429 | WP_000591074.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / sul1 / qacE / dfrA25 | - | 1..178868 | 178868 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13328.21 Da Isoelectric Point: 5.2421
>T262565 WP_000270043.1 NZ_CP109964:31284-31634 [Klebsiella pneumoniae]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|