Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 31284..31941 Replicon plasmid pNY13307-1
Accession NZ_CP109964
Organism Klebsiella pneumoniae isolate NY13307

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag OJ970_RS25650 Protein ID WP_000270043.1
Coordinates 31284..31634 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OJ970_RS25655 Protein ID WP_000124640.1
Coordinates 31639..31941 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OJ970_RS25605 (OJ970_25610) 26595..26774 + 180 Protein_37 helix-turn-helix domain-containing protein -
OJ970_RS25610 (OJ970_25615) 26839..27543 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
OJ970_RS25615 (OJ970_25620) 27758..28255 - 498 WP_000062185.1 hypothetical protein -
OJ970_RS25620 (OJ970_25625) 28258..28746 - 489 WP_001273096.1 DUF1643 domain-containing protein -
OJ970_RS25625 (OJ970_25630) 28843..29178 + 336 WP_000683476.1 hypothetical protein -
OJ970_RS25630 (OJ970_25635) 29193..29663 - 471 WP_001281821.1 hypothetical protein -
OJ970_RS25635 (OJ970_25640) 29656..30027 - 372 WP_000516916.1 hypothetical protein -
OJ970_RS25640 (OJ970_25645) 30038..30232 - 195 WP_000343597.1 hypothetical protein -
OJ970_RS25645 (OJ970_25650) 30573..31121 - 549 WP_001061574.1 transcriptional regulator -
OJ970_RS25650 (OJ970_25655) 31284..31634 + 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OJ970_RS25655 (OJ970_25660) 31639..31941 + 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
OJ970_RS25660 (OJ970_25665) 31968..32261 - 294 WP_001239997.1 chromosome segregation protein ParM -
OJ970_RS25665 (OJ970_25670) 32349..32621 - 273 WP_001043047.1 HU family DNA-binding protein -
OJ970_RS25670 (OJ970_25675) 32679..33206 - 528 WP_001236377.1 thermonuclease family protein -
OJ970_RS25675 (OJ970_25680) 33437..34294 - 858 WP_001167032.1 hypothetical protein -
OJ970_RS25680 (OJ970_25685) 34281..34511 - 231 WP_000972663.1 hypothetical protein -
OJ970_RS25685 (OJ970_25690) 34511..35029 - 519 WP_000210756.1 nitrite reductase -
OJ970_RS25690 (OJ970_25695) 35026..35472 - 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
OJ970_RS25695 (OJ970_25700) 35472..35831 - 360 WP_000422768.1 hypothetical protein -
OJ970_RS25700 (OJ970_25705) 35888..36316 - 429 WP_000591074.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / sul1 / qacE / dfrA25 - 1..178868 178868


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T262565 WP_000270043.1 NZ_CP109964:31284-31634 [Klebsiella pneumoniae]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT262565 WP_000124640.1 NZ_CP109964:31639-31941 [Klebsiella pneumoniae]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References