Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 137469..137733 | Replicon | plasmid p3 |
| Accession | NZ_CP109956 | ||
| Organism | Escherichia coli strain NC22 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | OI124_RS25780 | Protein ID | WP_001303307.1 |
| Coordinates | 137581..137733 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 137469..137531 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI124_RS25765 (133571) | 133571..134641 | - | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
| OI124_RS25770 (134660) | 134660..135868 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (136048) | 136048..136108 | - | 61 | NuclAT_2 | - | - |
| - (136048) | 136048..136108 | - | 61 | NuclAT_2 | - | - |
| - (136048) | 136048..136108 | - | 61 | NuclAT_2 | - | - |
| - (136048) | 136048..136108 | - | 61 | NuclAT_2 | - | - |
| OI124_RS25775 (136175) | 136175..136954 | - | 780 | WP_275450201.1 | protein FinQ | - |
| - (137469) | 137469..137531 | - | 63 | NuclAT_1 | - | Antitoxin |
| - (137469) | 137469..137531 | - | 63 | NuclAT_1 | - | Antitoxin |
| - (137469) | 137469..137531 | - | 63 | NuclAT_1 | - | Antitoxin |
| - (137469) | 137469..137531 | - | 63 | NuclAT_1 | - | Antitoxin |
| OI124_RS25780 (137581) | 137581..137733 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| OI124_RS25785 (137805) | 137805..138056 | - | 252 | WP_001291965.1 | hypothetical protein | - |
| - (138443) | 138443..138494 | - | 52 | NuclAT_3 | - | - |
| - (138443) | 138443..138494 | - | 52 | NuclAT_3 | - | - |
| - (138443) | 138443..138494 | - | 52 | NuclAT_3 | - | - |
| - (138443) | 138443..138494 | - | 52 | NuclAT_3 | - | - |
| OI124_RS25790 (138980) | 138980..139156 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| OI124_RS25795 (139365) | 139365..139574 | - | 210 | Protein_145 | hemolysin expression modulator Hha | - |
| OI124_RS25800 (139672) | 139672..140286 | - | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| OI124_RS25805 (140362) | 140362..142530 | - | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | vat / iroN / iroE / iroD / iroC / iroB / iutA / iucD / iucC / iucB / iucA | 1..255823 | 255823 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T262541 WP_001303307.1 NZ_CP109956:137581-137733 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT262541 NZ_CP109956:c137531-137469 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
