Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4789156..4789883 | Replicon | chromosome |
Accession | NZ_CP109953 | ||
Organism | Escherichia coli strain NC22 |
Toxin (Protein)
Gene name | higB | Uniprot ID | J7Q991 |
Locus tag | OI124_RS23305 | Protein ID | WP_000547564.1 |
Coordinates | 4789156..4789467 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OI124_RS23310 | Protein ID | WP_000126294.1 |
Coordinates | 4789464..4789883 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI124_RS23275 (4784298) | 4784298..4786007 | + | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
OI124_RS23280 (4786017) | 4786017..4786559 | + | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
OI124_RS23285 (4786559) | 4786559..4787326 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
OI124_RS23290 (4787323) | 4787323..4787733 | + | 411 | WP_228569532.1 | formate hydrogenlyase assembly protein HycH | - |
OI124_RS23295 (4787726) | 4787726..4788196 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
OI124_RS23300 (4788221) | 4788221..4788982 | + | 762 | WP_001026446.1 | hypothetical protein | - |
OI124_RS23305 (4789156) | 4789156..4789467 | + | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
OI124_RS23310 (4789464) | 4789464..4789883 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
OI124_RS23315 (4789997) | 4789997..4791421 | - | 1425 | WP_000110363.1 | 6-phospho-beta-glucosidase AscB | - |
OI124_RS23320 (4791430) | 4791430..4792887 | - | 1458 | WP_001107861.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
OI124_RS23325 (4793147) | 4793147..4794157 | + | 1011 | WP_001392554.1 | DNA-binding transcriptional regulator AscG | - |
OI124_RS23330 (4794306) | 4794306..4794833 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T262536 WP_000547564.1 NZ_CP109953:4789156-4789467 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT262536 WP_000126294.1 NZ_CP109953:4789464-4789883 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|