Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 4346930..4347623 | Replicon | chromosome |
| Accession | NZ_CP109953 | ||
| Organism | Escherichia coli strain NC22 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | OI124_RS21070 | Protein ID | WP_000415584.1 |
| Coordinates | 4346930..4347226 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | OI124_RS21075 | Protein ID | WP_000650107.1 |
| Coordinates | 4347228..4347623 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI124_RS21040 (4342605) | 4342605..4342919 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
| OI124_RS21045 (4342950) | 4342950..4343531 | - | 582 | WP_278136992.1 | NADPH:quinone oxidoreductase MdaB | - |
| OI124_RS21050 (4343641) | 4343641..4344990 | - | 1350 | WP_000673406.1 | quorum sensing histidine kinase QseC | - |
| OI124_RS21055 (4344987) | 4344987..4345646 | - | 660 | WP_001221491.1 | quorum sensing response regulator transcription factor QseB | - |
| OI124_RS21060 (4345798) | 4345798..4346190 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| OI124_RS21065 (4346243) | 4346243..4346725 | + | 483 | WP_000183494.1 | GyrI-like domain-containing protein | - |
| OI124_RS21070 (4346930) | 4346930..4347226 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| OI124_RS21075 (4347228) | 4347228..4347623 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| OI124_RS21080 (4347756) | 4347756..4349363 | + | 1608 | WP_001701096.1 | ABC transporter substrate-binding protein | - |
| OI124_RS21085 (4349501) | 4349501..4351759 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4335202..4347623 | 12421 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T262533 WP_000415584.1 NZ_CP109953:4346930-4347226 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT262533 WP_000650107.1 NZ_CP109953:4347228-4347623 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|