Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4224975..4225774 | Replicon | chromosome |
Accession | NZ_CP109953 | ||
Organism | Escherichia coli strain NC22 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | OI124_RS20475 | Protein ID | WP_000347251.1 |
Coordinates | 4224975..4225439 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | OI124_RS20480 | Protein ID | WP_001307405.1 |
Coordinates | 4225439..4225774 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI124_RS20445 (4219976) | 4219976..4220410 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
OI124_RS20450 (4220428) | 4220428..4221306 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
OI124_RS20455 (4221296) | 4221296..4222075 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
OI124_RS20460 (4222086) | 4222086..4222559 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
OI124_RS20465 (4222582) | 4222582..4223862 | - | 1281 | WP_000681903.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
OI124_RS20470 (4224111) | 4224111..4224920 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
OI124_RS20475 (4224975) | 4224975..4225439 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
OI124_RS20480 (4225439) | 4225439..4225774 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
OI124_RS20485 (4225923) | 4225923..4227494 | - | 1572 | WP_048943282.1 | galactarate dehydratase | - |
OI124_RS20490 (4227869) | 4227869..4229203 | + | 1335 | WP_000599652.1 | galactarate/glucarate/glycerate transporter GarP | - |
OI124_RS20495 (4229219) | 4229219..4229989 | + | 771 | WP_001058214.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T262532 WP_000347251.1 NZ_CP109953:c4225439-4224975 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |