Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 139386..139639 | Replicon | plasmid pKP1650-2 |
| Accession | NZ_CP109950 | ||
| Organism | Klebsiella pneumoniae strain KP1650 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OIS41_RS28695 | Protein ID | WP_001312851.1 |
| Coordinates | 139490..139639 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 139386..139445 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIS41_RS28655 (134768) | 134768..135112 | - | 345 | Protein_173 | IS6-like element IS26 family transposase | - |
| OIS41_RS28660 (135164) | 135164..135868 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OIS41_RS28665 (135893) | 135893..136093 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| OIS41_RS28670 (136113) | 136113..136859 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OIS41_RS28675 (136914) | 136914..137474 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OIS41_RS28680 (137606) | 137606..137806 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| OIS41_RS28685 (138192) | 138192..138791 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OIS41_RS28690 (138853) | 138853..139185 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (139386) | 139386..139445 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (139386) | 139386..139445 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (139386) | 139386..139445 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (139386) | 139386..139445 | - | 60 | NuclAT_1 | - | Antitoxin |
| OIS41_RS28695 (139490) | 139490..139639 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| OIS41_RS28700 (139923) | 139923..140171 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OIS41_RS28705 (140286) | 140286..140464 | + | 179 | Protein_183 | protein CopA/IncA | - |
| OIS41_RS28710 (140483) | 140483..141340 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OIS41_RS28715 (142279) | 142279..142932 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OIS41_RS28720 (143025) | 143025..143282 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OIS41_RS28725 (143215) | 143215..143616 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OIS41_RS28730 (143865) | 143865..144280 | + | 416 | Protein_188 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..145205 | 145205 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T262515 WP_001312851.1 NZ_CP109950:139490-139639 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT262515 NZ_CP109950:c139445-139386 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
