Detailed information of TA system TA262513

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 40091..40360
• Replicon: plasmid pKP1650-2
• Accession: NZ_CP109950
• Organism: Klebsiella pneumoniae strain KP1650

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OIS41_RS28075
• Protein ID: WP_001372321.1
• Coordinates: 40235..40360 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	40091..40156 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OIS41_RS28045	35801..36328	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
OIS41_RS28050	36386..36619	+	234	WP_000006003.1	DUF905 family protein	-
OIS41_RS28055	36680..38703	+	2024	Protein_53	ParB/RepB/Spo0J family partition protein	-
OIS41_RS28060	38772..39206	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
OIS41_RS28065	39203..39922	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	39934..40158	+	225	NuclAT_0	-	-
-	39934..40158	+	225	NuclAT_0	-	-
-	39934..40158	+	225	NuclAT_0	-	-
-	39934..40158	+	225	NuclAT_0	-	-
-	40091..40156	-	66	-	-	Antitoxin
OIS41_RS28070	40144..40293	+	150	Protein_56	plasmid maintenance protein Mok	-
OIS41_RS28075	40235..40360	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
OIS41_RS28080	40679..40975	-	297	Protein_58	hypothetical protein	-
OIS41_RS28085	41275..41571	+	297	WP_001272251.1	hypothetical protein	-
OIS41_RS28090	41682..42503	+	822	WP_001234445.1	DUF932 domain-containing protein	-
OIS41_RS28095	42800..43447	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
OIS41_RS28100	43724..44107	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
OIS41_RS28105	44388..45092	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2	-	1..145205	145205

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T262513 WP_001372321.1 NZ_CP109950:40235-40360 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT262513 NZ_CP109950:c40156-40091 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin