Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 39934..40360 | Replicon | plasmid pKP1650-2 |
Accession | NZ_CP109950 | ||
Organism | Klebsiella pneumoniae strain KP1650 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | OIS41_RS28075 | Protein ID | WP_001372321.1 |
Coordinates | 40235..40360 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 39934..40158 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIS41_RS28040 (35044) | 35044..35499 | - | 456 | Protein_50 | hypothetical protein | - |
OIS41_RS28045 (35801) | 35801..36328 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
OIS41_RS28050 (36386) | 36386..36619 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
OIS41_RS28055 (36680) | 36680..38703 | + | 2024 | Protein_53 | ParB/RepB/Spo0J family partition protein | - |
OIS41_RS28060 (38772) | 38772..39206 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
OIS41_RS28065 (39203) | 39203..39922 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- (39934) | 39934..40158 | + | 225 | NuclAT_0 | - | Antitoxin |
- (39934) | 39934..40158 | + | 225 | NuclAT_0 | - | Antitoxin |
- (39934) | 39934..40158 | + | 225 | NuclAT_0 | - | Antitoxin |
- (39934) | 39934..40158 | + | 225 | NuclAT_0 | - | Antitoxin |
OIS41_RS28070 (40144) | 40144..40293 | + | 150 | Protein_56 | plasmid maintenance protein Mok | - |
OIS41_RS28075 (40235) | 40235..40360 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
OIS41_RS28080 (40679) | 40679..40975 | - | 297 | Protein_58 | hypothetical protein | - |
OIS41_RS28085 (41275) | 41275..41571 | + | 297 | WP_001272251.1 | hypothetical protein | - |
OIS41_RS28090 (41682) | 41682..42503 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
OIS41_RS28095 (42800) | 42800..43447 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
OIS41_RS28100 (43724) | 43724..44107 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
OIS41_RS28105 (44388) | 44388..45092 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..145205 | 145205 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T262512 WP_001372321.1 NZ_CP109950:40235-40360 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT262512 NZ_CP109950:39934-40158 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|