Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3946..4199 | Replicon | plasmid pKP1650-2 |
| Accession | NZ_CP109950 | ||
| Organism | Klebsiella pneumoniae strain KP1650 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OIS41_RS27825 | Protein ID | WP_001312851.1 |
| Coordinates | 4050..4199 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 3946..4005 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIS41_RS27795 (453) | 453..653 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| OIS41_RS27800 (673) | 673..1419 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OIS41_RS27805 (1474) | 1474..2034 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OIS41_RS27810 (2166) | 2166..2366 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| OIS41_RS27815 (2752) | 2752..3351 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OIS41_RS27820 (3413) | 3413..3745 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (3946) | 3946..4005 | - | 60 | NuclAT_2 | - | Antitoxin |
| - (3946) | 3946..4005 | - | 60 | NuclAT_2 | - | Antitoxin |
| - (3946) | 3946..4005 | - | 60 | NuclAT_2 | - | Antitoxin |
| - (3946) | 3946..4005 | - | 60 | NuclAT_2 | - | Antitoxin |
| OIS41_RS27825 (4050) | 4050..4199 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| OIS41_RS27830 (4483) | 4483..4731 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OIS41_RS27835 (4846) | 4846..5024 | + | 179 | Protein_9 | protein CopA/IncA | - |
| OIS41_RS27840 (5043) | 5043..5900 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OIS41_RS27845 (6839) | 6839..7492 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OIS41_RS27850 (7585) | 7585..7842 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OIS41_RS27855 (7775) | 7775..8176 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OIS41_RS27860 (8425) | 8425..8840 | + | 416 | Protein_14 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..145205 | 145205 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T262509 WP_001312851.1 NZ_CP109950:4050-4199 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT262509 NZ_CP109950:c4005-3946 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
