Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 124592..125319 | Replicon | plasmid pKP1650-1 |
| Accession | NZ_CP109949 | ||
| Organism | Klebsiella pneumoniae strain KP1650 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | OIS41_RS27375 | Protein ID | WP_011251285.1 |
| Coordinates | 124592..124903 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OIS41_RS27380 | Protein ID | WP_011251286.1 |
| Coordinates | 124900..125319 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIS41_RS27350 (OIS41_27355) | 120111..120605 | - | 495 | WP_004212794.1 | thermonuclease family protein | - |
| OIS41_RS27355 (OIS41_27360) | 120783..121049 | + | 267 | WP_223175074.1 | DUF1173 family protein | - |
| OIS41_RS27360 (OIS41_27365) | 121082..121732 | + | 651 | WP_068893702.1 | DUF1173 family protein | - |
| OIS41_RS27370 (OIS41_27375) | 123950..124387 | + | 438 | Protein_132 | DDE-type integrase/transposase/recombinase | - |
| OIS41_RS27375 (OIS41_27380) | 124592..124903 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OIS41_RS27380 (OIS41_27385) | 124900..125319 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| OIS41_RS27385 (OIS41_27390) | 125466..126434 | + | 969 | WP_074428168.1 | IS5 family transposase | - |
| OIS41_RS27390 (OIS41_27395) | 126506..126871 | - | 366 | WP_048333448.1 | hypothetical protein | - |
| OIS41_RS27395 (OIS41_27400) | 126885..127673 | - | 789 | WP_040217257.1 | hypothetical protein | - |
| OIS41_RS27400 (OIS41_27405) | 127694..128314 | - | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| OIS41_RS27405 (OIS41_27410) | 128733..129368 | + | 636 | WP_223171879.1 | hypothetical protein | - |
| OIS41_RS27410 (OIS41_27415) | 129681..130151 | + | 471 | WP_048333570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iutA / rmpA2 / iroN / iucA / iucB / iucC / iucD | 1..194879 | 194879 | |
| - | inside | IScluster/Tn | - | - | 108136..133159 | 25023 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T262507 WP_011251285.1 NZ_CP109949:124592-124903 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT262507 WP_011251286.1 NZ_CP109949:124900-125319 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|