Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
Location | 1183882..1184404 | Replicon | chromosome |
Accession | NZ_CP109947 | ||
Organism | Pectobacterium cacticida strain CFCC10813 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | OI450_RS05560 | Protein ID | WP_264498146.1 |
Coordinates | 1183882..1184151 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | OI450_RS05565 | Protein ID | WP_264498147.1 |
Coordinates | 1184153..1184404 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI450_RS05545 (OI450_05545) | 1180869..1182440 | - | 1572 | WP_264498143.1 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
OI450_RS05550 (OI450_05550) | 1182546..1183112 | - | 567 | WP_264498144.1 | type 4 pilus major pilin | - |
OI450_RS05555 (OI450_05555) | 1183390..1183794 | + | 405 | WP_264498145.1 | H-NS family nucleoid-associated regulatory protein | - |
OI450_RS05560 (OI450_05560) | 1183882..1184151 | - | 270 | WP_264498146.1 | Txe/YoeB family addiction module toxin | Toxin |
OI450_RS05565 (OI450_05565) | 1184153..1184404 | - | 252 | WP_264498147.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OI450_RS05570 (OI450_05570) | 1184603..1184857 | + | 255 | Protein_1067 | YegP family protein | - |
OI450_RS05575 (OI450_05575) | 1184937..1185485 | + | 549 | WP_264498148.1 | hypothetical protein | - |
OI450_RS05580 (OI450_05580) | 1185626..1186834 | + | 1209 | WP_264495962.1 | IS256 family transposase | - |
OI450_RS05585 (OI450_05585) | 1186883..1187278 | - | 396 | WP_264498149.1 | hypothetical protein | - |
OI450_RS05590 (OI450_05590) | 1187324..1187569 | - | 246 | WP_264498150.1 | DNA-binding protein | - |
OI450_RS05595 (OI450_05595) | 1187638..1187940 | - | 303 | WP_039325217.1 | hypothetical protein | - |
OI450_RS05600 (OI450_05600) | 1188013..1188297 | - | 285 | WP_264498151.1 | hypothetical protein | - |
OI450_RS05605 (OI450_05605) | 1188447..1188647 | - | 201 | WP_264498152.1 | AlpA family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1175436..1188647 | 13211 | |
- | flank | IS/Tn | - | - | 1185626..1186834 | 1208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10520.01 Da Isoelectric Point: 9.7709
>T262488 WP_264498146.1 NZ_CP109947:c1184151-1183882 [Pectobacterium cacticida]
MKLLWTENAWQDYLYWQENDPGMVTKINDLIKDTKRSPFKGLGKPEPLKGDISGFWSRRISGEHRFVYRVSGKGEAQQLD
VVQCRFHYK
MKLLWTENAWQDYLYWQENDPGMVTKINDLIKDTKRSPFKGLGKPEPLKGDISGFWSRRISGEHRFVYRVSGKGEAQQLD
VVQCRFHYK
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|