Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 1176027..1176721 | Replicon | chromosome |
Accession | NZ_CP109947 | ||
Organism | Pectobacterium cacticida strain CFCC10813 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | - |
Locus tag | OI450_RS05515 | Protein ID | WP_209428711.1 |
Coordinates | 1176027..1176425 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | - |
Locus tag | OI450_RS05520 | Protein ID | WP_027711146.1 |
Coordinates | 1176428..1176721 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI450_RS05475 (OI450_05475) | 1171442..1172056 | + | 615 | WP_264498134.1 | YrbL family protein | - |
OI450_RS05480 (OI450_05480) | 1172295..1173173 | + | 879 | WP_264498135.1 | NAD(P)-dependent oxidoreductase | - |
OI450_RS05485 (OI450_05485) | 1173489..1173980 | + | 492 | WP_264498136.1 | YhfG family protein | - |
OI450_RS05490 (OI450_05490) | 1173973..1174557 | + | 585 | WP_264498137.1 | putative adenosine monophosphate-protein transferase Fic | - |
OI450_RS05495 (OI450_05495) | 1174680..1174826 | + | 147 | WP_264498138.1 | hypothetical protein | - |
OI450_RS05500 (OI450_05500) | 1174930..1175187 | - | 258 | WP_039351569.1 | BrnA antitoxin family protein | - |
OI450_RS05505 (OI450_05505) | 1175260..1175487 | - | 228 | Protein_1054 | hypothetical protein | - |
OI450_RS05510 (OI450_05510) | 1175487..1175903 | - | 417 | Protein_1055 | site-specific integrase | - |
OI450_RS05515 (OI450_05515) | 1176027..1176425 | - | 399 | WP_209428711.1 | type II toxin-antitoxin system YafO family toxin | Toxin |
OI450_RS05520 (OI450_05520) | 1176428..1176721 | - | 294 | WP_027711146.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
OI450_RS05525 (OI450_05525) | 1176982..1177722 | + | 741 | WP_264498139.1 | hypothetical protein | - |
OI450_RS05530 (OI450_05530) | 1178067..1178231 | + | 165 | WP_264498140.1 | hypothetical protein | - |
OI450_RS05535 (OI450_05535) | 1178281..1178745 | - | 465 | WP_264498141.1 | DUF6392 family protein | - |
OI450_RS05540 (OI450_05540) | 1178745..1180553 | - | 1809 | WP_264498142.1 | S-type pyocin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1175436..1188647 | 13211 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15268.59 Da Isoelectric Point: 7.5154
>T262487 WP_209428711.1 NZ_CP109947:c1176425-1176027 [Pectobacterium cacticida]
IRIFKSALIRKQLSQQELDDLAADFLSYKKDGVLPDTFGRDAPYDDDRTYPLVKEEQVAHIHLADADAPFPKFLRQFKRT
SDQAHLVYCQGAMDPDAYLLIIILKPEAHKMARNNNHMHKIGMMAEAFRMKH
IRIFKSALIRKQLSQQELDDLAADFLSYKKDGVLPDTFGRDAPYDDDRTYPLVKEEQVAHIHLADADAPFPKFLRQFKRT
SDQAHLVYCQGAMDPDAYLLIIILKPEAHKMARNNNHMHKIGMMAEAFRMKH
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|