Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 1744310..1744724 Replicon chromosome
Accession NZ_CP109933
Organism Staphylococcus aureus strain SASWT1215

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag NT398_RS08870 Protein ID WP_031267622.1
Coordinates 1744473..1744724 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NT398_RS08865 Protein ID WP_000028424.1
Coordinates 1744310..1744483 (-) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NT398_RS08825 (1739574) 1739574..1739864 - 291 WP_000665205.1 VRR-NUC domain-containing protein -
NT398_RS08830 (1739998) 1739998..1740096 + 99 WP_001801650.1 hypothetical protein -
NT398_RS08835 (1740205) 1740205..1742652 - 2448 WP_000884870.1 VapE family protein -
NT398_RS08840 (1742940) 1742940..1743140 - 201 WP_000265252.1 DUF1514 family protein -
NT398_RS08845 (1743208) 1743208..1743360 - 153 WP_000595263.1 transcriptional activator RinB -
NT398_RS08850 (1743357) 1743357..1743563 - 207 WP_000195810.1 DUF1381 domain-containing protein -
NT398_RS08855 (1743600) 1743600..1744133 - 534 WP_063653166.1 dUTPase -
NT398_RS08860 (1744148) 1744148..1744309 - 162 WP_000889684.1 hypothetical protein -
NT398_RS08865 (1744310) 1744310..1744483 - 174 WP_000028424.1 hypothetical protein Antitoxin
NT398_RS08870 (1744473) 1744473..1744724 - 252 WP_031267622.1 DUF1024 family protein Toxin
NT398_RS08875 (1744717) 1744717..1745024 - 308 Protein_1711 hypothetical protein -
NT398_RS08880 (1745021) 1745021..1745368 - 348 WP_000979209.1 YopX family protein -
NT398_RS08885 (1745365) 1745365..1745745 - 381 WP_001668982.1 hypothetical protein -
NT398_RS08890 (1745748) 1745748..1745954 - 207 WP_000693989.1 hypothetical protein -
NT398_RS08895 (1745968) 1745968..1746216 - 249 WP_060474161.1 SAV1978 family virulence-associated passenger protein -
NT398_RS08900 (1746216) 1746216..1746470 - 255 WP_000022722.1 DUF3310 domain-containing protein -
NT398_RS08905 (1746467) 1746467..1746871 - 405 WP_044426014.1 SA1788 family PVL leukocidin-associated protein -
NT398_RS08910 (1746871) 1746871..1747056 - 186 WP_001164629.1 DUF3113 family protein -
NT398_RS08915 (1747069) 1747069..1749021 - 1953 WP_161081393.1 DNA polymerase -
NT398_RS08920 (1749090) 1749090..1749647 - 558 WP_000645042.1 DUF2815 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - geh 1713591..1769400 55809


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9419.35 Da        Isoelectric Point: 3.9476

>T262440 WP_031267622.1 NZ_CP109933:c1744724-1744473 [Staphylococcus aureus]
MNNREKIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGIELDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT262440 WP_000028424.1 NZ_CP109933:c1744483-1744310 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References